KEGG   Homo sapiens (human): 122786Help
Entry
122786            CDS       T01001                                 

Gene name
FRMD6, C14orf31, EX1, Willin, c14_5320
Definition
(RefSeq) FERM domain containing 6
  KO
K16822  FERM domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    122786 (FRMD6)
   04392 Hippo signaling pathway - multiple species
    122786 (FRMD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FERM_M FERM_C FERM_N HTH_24
Motif
Other DBs
NCBI-GeneID: 122786
NCBI-ProteinID: NP_001253975
OMIM: 614555
HGNC: 19839
Ensembl: ENSG00000139926
Vega: OTTHUMG00000140294
Pharos: Q96NE9(Tbio)
UniProt: Q96NE9
Position
14q22.1
AA seq 622 aa AA seqDB search
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENG
RLISDRAARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPE
AYFPSWVVSKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDK
REIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
IYYTGCPMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDNLDLDMD
QLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRK
LKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMC
IYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDR
HSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFP
VKRTSKYFSLDLTHDEVPEFVV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattgaattttcataacaacagagtcatgcaagaccgccgcagtgtgtgcatt
ttccttcccaacgatgaatctctgaacatcatcataaatgttaagattctgtgtcaccag
ttgctggtccaggtttgtgacctgctcaggctaaaggactgccacctctttggactcagt
gttatacaaaataatgaacatgtgtatatggagttgtcacaaaagctttacaaatattgt
ccaaaagaatggaagaaagaggccagcaaggtacgacaatacgaagtcacttggggtatc
gaccaatttgggcctcctatgatcatccacttccgtgtgcagtactatgtggaaaatggc
agattgatcagtgacagagcagcaagatactattattactggcacctgagaaaacaagtt
cttcattctcagtgtgtgctccgagaggaggcctacttcctgctggcagcctttgccctg
caggctgatcttgggaacttcaaaaggaataagcactatggaaaatacttcgagccagag
gcttacttcccatcttgggttgtttccaagagggggaaggactacatcctgaagcacatt
ccaaacatgcacaaagatcagtttgcactaacagcttccgaagctcatcttaaatatatc
aaagaggctgtccgactggatgacgtcgctgttcattactacagattgtataaggataaa
agggaaattgaagcatcgctgactcttggattgaccatgaggggaatacagatttttcag
aatttagatgaagagaaacaattactttatgatttcccctggacaaatgttggaaaattg
gtgtttgtgggtaagaaatttgagattttgccagatggcttgccttctgcccggaagctc
atatactacacggggtgccccatgcgctccagacacctcctgcaacttctgagcaacagc
caccgcctctatatgaatctgcagcctgtcctgcgccatatccggaagctggaggaaaac
gaagagaagaagcagtaccgggaatcttacatcagtgacaacctggacctcgacatggac
cagctggaaaaacggtcgcgggccagcgggagcagtgcgggcagcatgaaacacaagcgc
ctgtcccgtcattccaccgccagccacagcagttcccacacctcgggcattgaggcagac
accaagccccgggacacggggccagaagacagctactccagcagtgccatccaccgcaag
ctgaaaacctgcagctcaatgaccagtcatggcagctcccacacctcaggggtggagagt
ggcggcaaagaccggctggaagaggacttacaggacgatgaaatagagatgttggttgat
gacccccgggatctggagcagatgaatgaagagtctctggaagtcagcccagacatgtgc
atctacatcacagaggacatgctcatgtcgcggaagctgaatggacactctgggttgatt
gtgaaagaaattgggtcttccacctcgagctcttcagaaacagttgttaagcttcgtggc
cagagtactgattctcttccacagactatatgtcggaaaccaaagacctccactgatcga
cacagcttgagcctcgatgacatcagactttaccagaaagacttcctgcgcattgcaggt
ctgtgtcaggacactgctcagagttacacctttggatgtggccatgaactggatgaggaa
ggcctctattgcaacagttgcttggcccagcagtgcatcaacatccaagatgcttttcca
gtcaaaagaaccagcaaatacttttctctggatctcactcatgatgaagttccagagttt
gttgtgtaa

DBGET integrated database retrieval system