KEGG   Homo sapiens (human): 122970
Entry
122970            CDS       T01001                                 

Gene name
ACOT4, PTE-Ib, PTE1B, PTE2B
Definition
(RefSeq) acyl-CoA thioesterase 4
  KO
K01068  acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    122970 (ACOT4)
   01040 Biosynthesis of unsaturated fatty acids
    122970 (ACOT4)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    122970 (ACOT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    122970 (ACOT4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     122970 (ACOT4)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   122970 (ACOT4)
SSDB
Motif
Pfam: BAAT_C Bile_Hydr_Trans DLH FSH1 Peptidase_S9
Other DBs
NCBI-GeneID: 122970
NCBI-ProteinID: NP_689544
OMIM: 614314
HGNC: 19748
Ensembl: ENSG00000177465
Vega: OTTHUMG00000169485
Pharos: Q8N9L9(Tbio)
UniProt: Q8N9L9
Structure
PDB: 
3K2I

Position
14q24.3
AA seq 421 aa
MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGEL
DLERAPALGGSFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLL
CQAQHERHFLPPGVRRQSVRAGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAG
HGFATLALAYYNFEDLPNNMDNISLEYFEEAVCYMLQHPQVKGPGIGLLGISLGADICLS
MASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLRRIKVAFSGLVDIVDIRNALV
GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGTGH
YIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK
L
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtcagcaacgctgatcctggagcccccaggccgctgctgctggaacgagccggtgcgc
attgccgtgcgcggcctggccccggagcagcgggttacgctgcgcgcgtccctgcgcgac
gagaagggcgcgctcttccgggcccacgcgcgctactgcgccgacgcccgcggcgagctg
gacctggagcgcgcacccgcgctgggcggcagcttcgcgggactcgagcccatggggctg
ctctgggccctggaacccgagaagcctttttggcgcttcctgaagcgggacgtacagatt
ccttttgtcgtggagttggaggtgctggacggccacgaccccgagcctggacggctgctg
tgccaggcgcagcacgagcgccacttcctcccgccaggggtgcggcgccagtcggtgcga
gcgggccgggtgcgcgccacgctcttcctgccgccaggacctggacccttcccagggatc
attgacatctttggtattggagggggcctcttggaatatcgagccagcctccttgctggc
catggctttgccacgttggctctagcttattataactttgaagatctccccaataacatg
gacaacatatccctggagtacttcgaagaagccgtatgctacatgcttcaacatccccag
gtaaaaggcccaggcattgggcttttgggcatttctctaggagctgatatttgtctctca
atggcctcattcttgaagaatgtctcagccacagtttccatcaatggatctgggatcagt
gggaacacagccatcaactataagcacagtagcattccaccattgggctatgacctgagg
agaatcaaggtagctttctcaggcctcgtggacattgtggatataaggaatgctctcgta
ggagggtacaagaaccccagcatgattccaatagagaaggcccaggggcccatcctgctc
attgttggtcaggatgaccataactggagaagtgagttgtatgcccaaacagtctctgaa
cggttacaggcccatggaaaggaaaaaccccagatcatctgttaccctgggactgggcat
tacatcgagcctccttacttccccctgtgcccagcttcccttcacagattactgaacaaa
catgttatatggggtggggagcccagggctcattctaaggcccaggaagatgcctggaag
caaattctagccttcttctgcaaacacctgggaggtacccagaaaacagctgtccctaaa
ttgtaa

DBGET integrated database retrieval system