KEGG   Homo sapiens (human): 123Help
Entry
123               CDS       T01001                                 

Gene name
PLIN2, ADFP, ADRP
Definition
(RefSeq) perilipin 2
  KO
K17284  perilipin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    123 (PLIN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    123 (PLIN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   123 (PLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Perilipin SH3BP5
Motif
Other DBs
NCBI-GeneID: 123
NCBI-ProteinID: NP_001113
OMIM: 103195
HGNC: 248
Ensembl: ENSG00000147872
Vega: OTTHUMG00000019624
Pharos: Q99541(Tbio)
UniProt: Q99541 Q6FHZ7
Position
9p22.1
AA seq 437 aa AA seqDB search
MASVAVDPQPSVVTRVVNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMAENGVKTITSV
AMTSALPIIQKLEPQIAVANTYACKGLDRIEERLPILNQPSTQIVANAKGAVTGAKDAVT
TTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENAL
TKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVK
EAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDES
HCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNA
ASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGA
EMDKSSQETQRSEHKTH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgttgcagttgatccacaaccgagtgtggtgactcgggtggtcaacctgccc
ttggtgagctccacgtatgacctcatgtcctcagcctatctcagtacaaaggaccagtat
ccctacctgaagtctgtgtgtgagatggcagagaacggtgtgaagaccatcacctccgtg
gccatgaccagtgctctgcccatcatccagaagctagagccgcaaattgcagttgccaat
acctatgcctgtaaggggctagacaggattgaggagagactgcctattctgaatcagcca
tcaactcagattgttgccaatgccaaaggcgctgtgactggggcaaaagatgctgtgacg
actactgtgactggggccaaggattctgtggccagcacgatcacaggggtgatggacaag
accaaaggggcagtgactggcagtgtggagaagaccaagtctgtggtcagtggcagcatt
aacacagtcttggggagtcggatgatgcagctcgtgagcagtggcgtagaaaatgcactc
accaaatcagagctgttggtagaacagtacctccctctcactgaggaagaactagaaaaa
gaagcaaaaaaagttgaaggatttgatctggttcagaagccaagttattatgttagactg
ggatccctgtctaccaagcttcactcccgtgcctaccagcaggctctcagcagggttaaa
gaagctaagcaaaaaagccaacagaccatttctcagctccattctactgttcacctgatt
gaatttgccaggaagaatgtgtatagtgccaatcagaaaattcaggatgctcaggataag
ctctacctctcatgggtagagtggaaaaggagcattggatatgatgatactgatgagtcc
cactgtgctgagcacattgagtcacgtactcttgcaattgcccgcaacctgactcagcag
ctccagaccacgtgccacaccctcctgtccaacatccaaggtgtaccacagaacatccaa
gatcaagccaagcacatgggggtgatggcaggcgacatctactcagtgttccgcaatgct
gcctcctttaaagaagtgtctgacagcctcctcacttctagcaaggggcagctgcagaaa
atgaaggaatctttagatgacgtgatggattatcttgttaacaacacgcccctcaactgg
ctggtaggtcccttttatcctcagctgactgagtctcagaatgctcaggaccaaggtgca
gagatggacaagagcagccaggagacccagcgatctgagcataaaactcattaa

DBGET integrated database retrieval system