KEGG   Homo sapiens (human): 123041Help
Entry
123041            CDS       T01001                                 

Gene name
SLC24A4, AI2A5, NCKX4, SHEP6, SLC24A2
Definition
(RefSeq) solute carrier family 24 member 4
  KO
K13752  solute carrier family 24 (sodium/potassium/calcium exchanger), member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Disease
H00615  Amelogenesis imperfecta
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    123041 (SLC24A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    123041 (SLC24A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC24: Na+/(Ca2+-K+) exchanger
   123041 (SLC24A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_Ca_ex
Motif
Other DBs
NCBI-GeneID: 123041
NCBI-ProteinID: NP_705932
OMIM: 609840
HGNC: 10978
Ensembl: ENSG00000140090
Vega: OTTHUMG00000167589
Pharos: Q8NFF2(Tbio)
UniProt: Q8NFF2
Position
14q32.12
AA seq 622 aa AA seqDB search
MALRGTLRPLKVRRRREMLPQQVGFVCAVLALVCCASGLFGSLGHKTASASKRVLPDTWR
NRKLMAPVNGTQTAKNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDD
FFVPSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFN
ILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISVIVLIVFIYDEQIVWWEGLVLIILYVF
YILIMKYNVKMQAFFTVKQKSIANGNPVNSELEAGNDFYDGSYDDPSVPLLGQVKEKPQY
GKNPVVMVDEIMSSSPPKFTFPEAGLRIMITNKFGPRTRLRMASRIIINERQRLINSANG
VSSKPLQNGRHENIENGNVPVENPEDPQQNQEQQPPPQPPPPEPEPVEADFLSPFSVPEA
RGDKVKWVFTWPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYIMVWLVTIIGY
TLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGL
QTMVVNYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGVYVLVLYAIFLC
FSIMIEFNVFTFVNLPMCREDD
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccgcgggaccctccggccgctcaaagttcgcaggaggcgagagatgctgccg
cagcaagtcggcttcgtgtgcgcggtgctggccctggtgtgctgtgcgtccggcctcttc
ggcagcttggggcacaaaacagcttctgctagcaaacgtgtcctgccagacacgtggaga
aatagaaagttgatggccccagtgaatgggacacagacagccaagaactgcacagatcct
gcgattcacgagttccccacagatctgttctccaataaggagcgacagcacggagccgtc
ctgctgcacatccttggtgctctgtatatgttctatgccttggccatagtgtgcgatgac
ttctttgttccgtctctagagaagatctgtgagagactccatctgagcgaagatgtggct
ggagccaccttcatggctgcaggaagctcaacgccagagctgtttgcgtctgttattggg
gtgttcatcacccatggggacgtcggggtgggcaccatcgtgggctctgctgtgttcaac
atcctgtgcataattggagtgtgcggactgtttgctggccaggtggtccgtctgacgtgg
tgggccgtgtgccgagactccgtgtactacaccatctctgtcatcgtgctcatcgtgttc
atatatgatgaacaaattgtgtggtgggaaggcctggtgctcatcatcttgtatgtgttt
tatattctgatcatgaagtacaatgtgaagatgcaagcctttttcacagtcaaacaaaag
agcattgcaaacggtaacccggtcaacagtgagctggaggctggtaatgatttctatgac
ggtagctatgatgacccttccgtgccattgctggggcaagtgaaggagaagccacagtat
ggcaagaaccccgtggtgatggtggacgagattatgagctccagccctcccaagttcacc
ttccctgaagcaggcttacgaatcatgatcaccaataagtttggacccaggacccgacta
cggatggccagcaggatcatcattaatgagcggcagagactgatcaactcggccaatggt
gtgagcagtaagccgcttcaaaacgggaggcacgagaacattgagaacgggaatgttcct
gtggaaaaccccgaagaccctcagcagaatcaggagcagcagccgccgccacagccacca
ccgccagagccagagccggtggaggctgacttcctgtcccccttctccgtgccggaggcc
agaggggacaaggtcaagtgggtgttcacctggcccctcatcttcctcctgtgcgtcacc
attcccaactgcagcaagccccgctgggagaagttcttcatggtcaccttcatcaccgcc
acgctgtggatcgctgtgttctcctacatcatggtgtggctggtgactattatcggatac
acacttgggatcccggatgtcatcatgggcattactttcctggcagcagggacaagtgtt
ccagactgcatggccagcctaattgtggcgagacaaggccttggggacatggcagtctcc
aacaccataggaagcaacgtgtttgacatcctggtaggacttggtgtaccgtggggcctg
cagaccatggttgttaattatggatcaacagtgaagatcaacagccgggggctggtctat
tccgtggtcctgttgctgggctctgtcgctctcaccgtcctcggcatccacctaaacaag
tggcgactggaccggaagctgggtgtctacgtgctggttctctacgccatcttcttgtgc
ttctccataatgatagagtttaacgtctttaccttcgtcaacttgccgatgtgccgggaa
gacgattag

DBGET integrated database retrieval system