KEGG   Homo sapiens (human): 123096
Entry
123096            CDS       T01001                                 

Gene name
SLC25A29, C14orf69, CACL, ORNT3
Definition
(RefSeq) solute carrier family 25 member 29
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    123096 (SLC25A29)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    123096 (SLC25A29)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   123096 (SLC25A29)
SSDB
Motif
Pfam: Mito_carr HTH_26
Other DBs
NCBI-GeneID: 123096
NCBI-ProteinID: NP_001034444
OMIM: 615064
HGNC: 20116
Ensembl: ENSG00000197119
Vega: OTTHUMG00000171569
Pharos: Q8N8R3(Tbio)
UniProt: Q8N8R3
Position
14q32.2
AA seq 303 aa
MALDFLAGCAGGVAGVLVGHPFDTVKVRLQVQSVEKPQYRGTLHCFKSIIKQESVLGLYK
GLGSPLMGLTFINALVFGVQGNTLRALGHDSPLNQFLAGAAAGAIQCVICCPMELAKTRL
QLQDAGPARTYKGSLDCLAQIYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALG
CEPGDRLLVPKLLLAGGTSGIVSWLSTYPVDVVKSRLQADGLRGAPRYRGILDCVHQSYR
AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPAAPAGPALAQP
SSL
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcgctggacttcttggctggatgcgcggggggtgtggcaggcgtgcttgtgggacac
ccgtttgacacggtcaaggtacggcttcaggtccagagcgtggagaagcctcagtaccgc
gggacgttgcactgcttcaagtccatcatcaagcaagagagcgtgctgggcctgtacaag
ggcctgggctcgccgctcatggggctcaccttcatcaacgcgctggtgttcggggtgcag
ggcaacaccctccgggccctgggccacgactcgcccctcaaccagttcctggcaggtgcg
gcggcgggcgccatccagtgcgtcatctgctgccccatggagctggccaagacgcggctg
cagctgcaggacgcgggcccagcgcgcacctacaagggctcgctggactgcctcgcgcag
atctacgggcacgagggtctgcgtggcgtcaaccggggcatggtgtccacgttgctgcgt
gagacgcccagcttcggcgtctacttcctcacctatgacgctctcacgcgggcgctgggc
tgcgagccgggcgaccgcctgctggtgcccaagctgctgttggcgggcggtacgtcaggc
atcgtgtcctggctctctacctatcctgtggacgtggtcaagtcgcggctgcaggcggac
ggactgcggggcgccccgcgctaccgcggcatcctggactgcgtgcaccagagctaccgc
gccgagggctggcgcgtcttcacacgggggctggcgtccacgctgctgcgcgccttcccc
gtcaacgctgccaccttcgccaccgtcacggtggtgctcacctacgcgcgcggcgaggag
gccgggcccgagggcgaggctgtgcccgccgcccctgcggggcctgccctggcgcagccc
tccagcctgtga

DBGET integrated database retrieval system