KEGG   Homo sapiens (human): 1232Help
Entry
1232              CDS       T01001                                 

Gene name
CCR3, CC-CKR-3, CD193, CKR3, CMKBR3
Definition
(RefSeq) C-C motif chemokine receptor 3
  KO
K04178  C-C chemokine receptor type 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
Network
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00462  KSHV vCCL1/2/3 to CCR signaling pathway
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1232 (CCR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1232 (CCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1232 (CCR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1232 (CCR3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    1232 (CCR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1232 (CCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1232 (CCR3)
   04050 Cytokine receptors [BR:hsa04050]
    1232 (CCR3)
   04090 CD molecules [BR:hsa04090]
    1232 (CCR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1232 (CCR3)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1232 (CCR3)
CD molecules [BR:hsa04090]
 Proteins
  1232 (CCR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF3112
Motif
Other DBs
NCBI-GeneID: 1232
NCBI-ProteinID: NP_001828
OMIM: 601268
HGNC: 1604
Ensembl: ENSG00000183625
Vega: OTTHUMG00000133484
Pharos: P51677(Tchem)
UniProt: P51677 A0A024R2Z3 Q8TDP5
Position
3p21.31
AA seq 355 aa AA seqDB search
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctcactagatacagttgagacctttggtaccacatcctactatgatgacgtg
ggcctgctctgtgaaaaagctgataccagagcactgatggcccagtttgtgcccccgctg
tactccctggtgttcactgtgggcctcttgggcaatgtggtggtggtgatgatcctcata
aaatacaggaggctccgaattatgaccaacatctacctgctcaacctggccatttcggac
ctgctcttcctcgtcacccttccattctggatccactatgtcagggggcataactgggtt
tttggccatggcatgtgtaagctcctctcagggttttatcacacaggcttgtacagcgag
atctttttcataatcctgctgacaatcgacaggtacctggccattgtccatgctgtgttt
gcccttcgagcccggactgtcacttttggtgtcatcaccagcatcgtcacctggggcctg
gcagtgctagcagctcttcctgaatttatcttctatgagactgaagagttgtttgaagag
actctttgcagtgctctttacccagaggatacagtatatagctggaggcatttccacact
ctgagaatgaccatcttctgtctcgttctccctctgctcgttatggccatctgctacaca
ggaatcatcaaaacgctgctgaggtgccccagtaaaaaaaagtacaaggccatccggctc
atttttgtcatcatggcggtgtttttcattttctggacaccctacaatgtggctatcctt
ctctcttcctatcaatccatcttatttggaaatgactgtgagcggagcaagcatctggac
ctggtcatgctggtgacagaggtgatcgcctactcccactgctgcatgaacccggtgatc
tacgcctttgttggagagaggttccggaagtacctgcgccacttcttccacaggcacttg
ctcatgcacctgggcagatacatcccattccttcctagtgagaagctggaaagaaccagc
tctgtctctccatccacagcagagccggaactctctattgtgttttag

DBGET integrated database retrieval system