KEGG   Homo sapiens (human): 123228Help
Entry
123228            CDS       T01001                                 

Gene name
SENP8, DEN1, NEDP1, PRSC2
Definition
(RefSeq) SUMO peptidase family member, NEDD8 specific
  KO
K08597  sentrin-specific protease 8 [EC:3.4.22.68]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    123228 (SENP8)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    123228 (SENP8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     123228 (SENP8)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C48: Ulp1 endopeptidase family
   123228 (SENP8)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   123228 (SENP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C48
Motif
Other DBs
NCBI-GeneID: 123228
NCBI-ProteinID: NP_001159812
OMIM: 608659
HGNC: 22992
Ensembl: ENSG00000166192
Vega: OTTHUMG00000133441
Pharos: Q96LD8(Tbio)
UniProt: Q96LD8
Structure
PDB: 

Position
15q23
AA seq 212 aa AA seqDB search
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgtagtcttgagttacatggacagtctactgcggcaatcagatgtctcacta
ttggatccgccaagctggctcaatgaccatattattgggtttgcgtttgagtactttgcc
aacagtcagtttcatgactgctctgatcacgtcagtttcatcagccctgaagtcacccag
ttcatcaagtgcactagcaacccagcagagattgccatgttccttgaaccactggacctc
cccaacaagagagttgtatttttagccatcaatgataactccaaccaggcagctggagga
acccactggagtttattggtctacctccaagataaaaatagcttttttcattatgattcc
catagcaggagcaactcagttcacgcaaagcaggtagcagagaaactggaggctttctta
ggcagaaaaggagacaaactggcctttgtggaagagaaagcccctgcccaacaaaacagc
tatgactgtgggatgtacgtgatatgtaacactgaggccttgtgtcagaacttctttagg
caacagacagaatcactgctgcagctactcacccctgcatacatcacaaagaagagggga
gaatggaaagatctcattaccacacttgctaaaaagtag

DBGET integrated database retrieval system