KEGG   Homo sapiens (human): 123264Help
Entry
123264            CDS       T01001                                 

Gene name
SLC51B, OSTB, OSTBETA
Definition
(RefSeq) solute carrier family 51 beta subunit
  KO
K14361  organic solute transporter subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    123264 (SLC51B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    123264 (SLC51B)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC51: Transporter of steroid-derived molecules
   123264 (SLC51B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OSTbeta DUF2140 HNH_3
Motif
Other DBs
NCBI-GeneID: 123264
NCBI-ProteinID: NP_849190
OMIM: 612085
HGNC: 29956
Ensembl: ENSG00000186198
Vega: OTTHUMG00000133116
Pharos: Q86UW2(Tbio)
UniProt: Q86UW2
Position
15q22.31
AA seq 128 aa AA seqDB search
MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQ
ASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFL
PDVPETES
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggagcacagtgagggggctcccggagacccagccggtactgtggtaccccaggagctg
ctggaagagatgctttggttttttcgtgtggaagatgcatctccctggaatcattccatc
cttgccctggcagctgtggtggtcattataagcatggtcctcctgggaagaagcatccag
gcaagcagaaaagaaaagatgcagccaccagaaaaagaaactccagaagtcctgcatttg
gatgaggccaaggatcacaacagcctaaacaacctaagagaaactttgctctcagaaaag
ccaaacttggcccaggtggaacttgagttaaaagagagagatgtgctgtcagttttcctt
ccggatgtaccagaaactgagagctag

DBGET integrated database retrieval system