KEGG   Homo sapiens (human): 123346
Entry
123346            CDS       T01001                                 
Symbol
HIGD2B, HIGD2BP
Name
(RefSeq) HIG1 hypoxia inducible domain family member 2B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: HIG_1_N
Other DBs
NCBI-GeneID: 123346
NCBI-ProteinID: NP_001337861
HGNC: 26984
Ensembl: ENSG00000175202
Position
15:complement(72675798..72686182)
AA seq 106 aa
MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENPVVPIGFLCTAAVL
TNGLYCFHQGNSQCSRLMMHTQIAAQGFTIAAILLGLAATAMKSPP
NT seq 321 nt   +upstreamnt  +downstreamnt
atggcgactctcggctttgtgactccggaggccccctttgaatcatcgaagccccccatc
tttgaggggcttagccccactgtttacagcaatccagagggtttcaaggaaaagttcctt
cgcaagacccgcgagaatccggtggtacccataggtttcctgtgcacggcggccgtcctc
accaacggcctctactgcttccaccagggcaacagccaatgttcacggcttatgatgcac
acccagatcgccgcccagggcttcaccattgcagccatcttgctgggtctagctgccacc
gctatgaagtctccaccctga

DBGET integrated database retrieval system