KEGG   Homo sapiens (human): 123688Help
Entry
123688            CDS       T01001                                 

Gene name
HYKK, AGPHD1
Definition
(RefSeq) hydroxylysine kinase
  KO
K18201  hydroxylysine kinase [EC:2.7.1.81]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    123688 (HYKK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.81  hydroxylysine kinase
     123688 (HYKK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APH EcKinase
Motif
Other DBs
NCBI-GeneID: 123688
NCBI-ProteinID: NP_001013641
OMIM: 614681
HGNC: 34403
Ensembl: ENSG00000188266
Vega: OTTHUMG00000177204
Pharos: A2RU49(Tbio)
UniProt: A2RU49
Position
15q25.1
AA seq 373 aa AA seqDB search
MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPT
EYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKS
YLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKN
VPLLEKYLYALGQNRNREIVEHVIHLFKEEVMTKLSHFRECINHGDLNDHNILIESSKSA
SGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSPIQVGGHVLAGFESITPLTAV
EKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFDMGQKAVEEIW
FETAKSYESGISM
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtggaaactatcagcagtcagaggctcttagcaaacccactttcagtgaggaa
caagcctctgcgttagtggagtcagtgtttgggttgaaagtttccaaggtccggccactt
cctagctatgatgaccaaaactttcatgtctacgtttcaaaaaccaaagatggcccaact
gaatatgtcctcaaaataagcaacaccaaggctagcaaaaatccagacctgattgaagtg
cagaatcacatcatcatgtttctgaaagccgctggatttccaacagcctctgtgtgtcac
actaaaggagacaacacagcttctctcgtgtctgtagatagtggctctgaaatcaaaagc
tacttggtgaggctgctgacttacctcccaggaagacccatcgctgagcttcccgtcagc
ccccagctattgtatgaaattggaaaactagctgccaaattggataagacactgcagaga
ttccatcacccaaagttaagtagtcttcatcgggagaacttcatctggaatctgaaaaat
gttcctcttctggagaaatacctgtatgccctgggccagaatcgaaaccgagagattgtt
gagcatgtcattcatctgttcaaggaggaagtaatgaccaaattaagtcattttcgagaa
tgtatcaatcacggagatcttaatgaccataatattttaatagagtccagcaagtcagcc
tctggaaatgctgaatatcaagtgtctgggattttagactttggtgacatgagctatggc
tactatgtgtttgaagtggcaattaccatcatgtacatgatgattgagagcaagagtcct
atacaagtaggaggccatgtccttgcagggtttgaaagcatcaccccactgacagctgta
gagaagggtgctttgtttttacttgtatgcagtcgtttttgtcagtcacttgtcatggct
gcatactcttgccagctatacccagagaacaaagactatctcatggttactgcaaaaacc
gggtggaaacacttacagcaaatgtttgacatgggtcagaaagctgtagaagaaatctgg
tttgaaactgccaaatcctatgaatctgggatctccatgtga

DBGET integrated database retrieval system