KEGG   Homo sapiens (human): 123775
Entry
123775            CDS       T01001                                 
Symbol
C16orf46
Name
(RefSeq) chromosome 16 open reading frame 46
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4529
Other DBs
NCBI-GeneID: 123775
NCBI-ProteinID: NP_689550
HGNC: 26525
Ensembl: ENSG00000166455
Pharos: Q6P387(Tdark)
UniProt: Q6P387
Position
16:complement(81053497..81077238)
AA seq 395 aa
MDLCQKNETDLENAENNEIQFTEETEPTYTCPDGKSEKNHVYCLLDVSDITLEQDEKAKE
FIIGTGWEEAVQGWGRTSPAACIWPRKIPKKARVGEGACSDCLVCVNLSHWSLQTKPPTE
GGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFRAEKKSLQIKEFIWCNKDWAIPGT
NRGKASGNPSGGAHRGLSIPGPLTSRALLVLPPLKASLSNALDVLGKKSKNSFLQSEEKV
LDVEKDGCVAYAYGLKTADGKGEKRASELAKHPMVNDTPSSPSPAAQISLLTDPEQRCLH
WSLLSEKNLACPPDPSNVRYLAALQLLQKRGVQSYKSKFKAKEPRSPVITRKHVLPKAKQ
ENRPQMLETKVFPRPVLPSLTVSRVIIPVSTHRIL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatctctgtcagaaaaatgagactgacttagaaaatgctgaaaataatgaaattcag
ttcacagaagaaacagaaccaacctatacttgtccagatggaaaaagtgaaaaaaatcat
gtttattgtcttctcgatgtcagtgacattacgcttgaacaagatgaaaaagccaaagag
tttattattggaactggatgggaagaggcagtccaagggtggggaaggacttctccagct
gcctgcatctggccgaggaagataccaaaaaaggcgagggtaggggaaggtgcctgcagc
gactgcttggtgtgtgttaacctctcccactggagcctccagaccaagcctcctactgag
gggggcccagagaaggatcagagcagcccctcccagactcaggcagccccccagggcccc
agcactgcttccagggcaattagcgacatctgctttcccacctactttcgagcagagaaa
aaaagtctgcaaatcaaggagtttatttggtgcaacaaagactgggccatccccggcact
aataggggcaaggcctctgggaatcccagtggaggggcccacagagggctgtccatccca
ggccccctgacttccagggccctcctagttctgcctcccctgaaggcttcactttcaaat
gctttggatgttctgggtaagaagagtaagaactctttcttgcagtcagaagagaaggtg
ctggatgtggaaaaggatgggtgtgtggcttatgcatatggcttgaaaacagcagatggg
aaaggtgaaaaaagagccagtgagctggccaaacaccctatggtcaacgacacgccatcc
tccccttccccagcggcccagatatccctgctgaccgatccggagcagcgctgcctgcat
tggtccctcctgtctgagaaaaacctggcgtgccctccagaccccagcaacgttcgctac
cttgctgccttgcagcttctgcagaaacggggagtgcaaagctacaaatccaaattcaaa
gccaaggagccaagatctcctgtgatcacccgaaagcatgttctcccaaaggccaagcag
gaaaacaggccccaaatgctggagaccaaagttttcccaagacctgtcttgccgtctctc
acagtgagcagagttatcattcctgtctctacccacaggatcctctga

DBGET integrated database retrieval system