KEGG   Homo sapiens (human): 123920
Entry
123920            CDS       T01001                                 
Symbol
CMTM3, BNAS2, CKLFSF3
Name
(RefSeq) CKLF like MARVEL transmembrane domain containing 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MARVEL DUF6111 CbiQ
Other DBs
NCBI-GeneID: 123920
NCBI-ProteinID: NP_653202
OMIM: 607886
HGNC: 19174
Ensembl: ENSG00000140931
Pharos: Q96MX0(Tbio)
UniProt: Q96MX0 A0A024R6Y8
Position
16:66603996..66613892
AA seq 182 aa
MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYV
ASSASAFLTAPLLEFLLALYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFAISITA
IAKYSDGASKAAGVFGFFATIVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEENSDSD
SD
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtggcccccagaccccgaccccgacccggaccccgagcctgccggcggctcccgtccc
ggccccgcggtccccgggctccgcgccctgctgccggcgcgggctttcctctgctctctc
aaaggccgcctcctgctggccgagtcgggtctctcattcatcacttttatctgctatgtg
gcgtcctcagcatctgccttcctcacagcgcctctgctggagttcctgctggccttgtac
ttcctctttgctgatgccatgcagctgaatgacaagtggcagggcttgtgctggcccatg
atggacttcctgcgctgtgtcaccgcggccctcatctactttgctatctccatcacggcc
atcgccaagtactcggatggggcttccaaagccgctggggtgtttggcttctttgctacc
atcgtgtttgcaactgatttctacctgatctttaacgacgtggccaaattcctcaaacaa
ggggactctgcagatgagaccacagcccacaagacagaagaagagaattccgactcggac
tctgactga

DBGET integrated database retrieval system