KEGG   Homo sapiens (human): 124446Help
Entry
124446            CDS       T01001                                 

Gene name
TMEM219, IGFBP-3R
Definition
(RefSeq) transmembrane protein 219
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM219
Motif
Other DBs
NCBI-GeneID: 124446
NCBI-ProteinID: NP_001077082
HGNC: 25201
Ensembl: ENSG00000149932
Vega: OTTHUMG00000177105
Pharos: Q86XT9(Tdark)
UniProt: Q86XT9 A0A024R618
Position
16p11.2
AA seq 240 aa AA seqDB search
MGNCQAGHNLHLCLAHHPPLVCATLILLLLGLSGLGLGSFLLTHRTGLRSPDIPQDWVSF
LRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGS
SAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVS
VWSHEGLVLTKLLTSEELALCGSRLLVLGSFLLLFCGLLCCVTAMCFHPRRESHWSRTRL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggcaactgccaggcagggcacaacctgcacctgtgtctggcccaccacccacctctg
gtctgtgccactttgatcctgctgctccttggcctctctggcctgggccttggcagcttc
ctcctcacccacaggactggcctgcgcagccctgacatcccccaggactgggtctctttt
ttgagatcttttggccagctgaccctgtgtcccaggaatgggacagtcacagggaagtgg
cgagggtctcacgtcgtgggcttgctgaccaccttgaacttcggagacggtccagacagg
aacaagacccggacattccaggccacagtcctgggaagtcagatgggattgaaaggatct
tctgcaggacaactggtccttatcacagccagggtgaccacagaaaggactgcaggaacc
tgcctatattttagtgctgttccaggaatcctaccctccagccagccacccatatcctgc
tcagaggagggggctggaaatgccaccctgagccctagaatgggtgaggaatgtgttagt
gtctggagccatgaaggccttgtgctgaccaagctgctcacctcggaggagctggctctg
tgtggctccaggctgctggtcttgggctccttcctgcttctcttctgtggccttctctgc
tgtgtcactgctatgtgcttccacccgcgccgggagtcccactggtctagaacccggctc
tga

DBGET integrated database retrieval system