KEGG   Homo sapiens (human): 124751
Entry
124751            CDS       T01001                                 
Symbol
KRBA2
Name
(RefSeq) KRAB-A domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: KRAB Integrase_H2C2
Other DBs
NCBI-GeneID: 124751
NCBI-ProteinID: NP_998762
HGNC: 26989
Ensembl: ENSG00000184619
Pharos: Q6ZNG9(Tdark)
UniProt: Q6ZNG9
Position
17:complement(8358822..8376704)
AA seq 492 aa
MPSFLVPSLVSSPVLLKLLFSPGPKTIWSLWQQPMLFQEATAFENMTKDWNYLEGSQKDC
YRDTMLDSYENTVPQGSFLQLSMMPQRAGNDPPGVSNASEMEMEISNMREKFLMSVTKLV
ESKSYNSKVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEKLIEATHGE
RDRIRYYVHKEELFDILHDTHLSIGHGGRTRMLKELQGKYGNVTKEVIVLYLTLCKQCHQ
KNPVPKRGLAPKPMTFKDIDSTCQVEILDMQSSADGEFKFILYYQDHSTKFIILRPLRTK
QAHEVVSVLLDIFTILGTPSVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGS
LEGASRDVKNMISTWMQSNHSCHWAKGLRFMQMVRNQAFDVSLQQSPFEAMFGYKAKFGL
YSSNLPRETVATLQTEEELEIAEEQLENSLWIRQEERAEIGADRSDMDDDMDPTPEASEP
STSQGTSGLLCW
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgccttcattcctggtgccctctcttgtctcttccccagtcctgctgaagctgctcttt
agcccaggccccaagactatatggtccctgtggcagcagccaatgttgtttcaggaagca
acagcatttgaaaatatgaccaaagattggaattatttagaaggctctcaaaaggattgc
tacagagacacaatgctggacagttatgagaacacggtcccacagggatccttcttacag
ctctccatgatgcctcagagagctggaaatgatccacctggggtttcaaatgcaagtgaa
atggaaatggagataagtaacatgagagaaaagtttcttatgagtgtaacaaagttagta
gaaagcaaaagttacaacagcaaggtattttccaaagaaaagtactttcaaacaataaag
gaagttaaagaagctaaagaaaaagggaagaagtcatcacgtgattatcgccgtgcagca
aaatatgatgtgatctctgtacagggcacagagaaactgatagaggctactcatggagaa
cgtgatcgaatacggtattatgtacataaggaagagttgtttgatattcttcatgataca
catctcagtattggacatggtgggcggacacgcatgctcaaggagctgcaaggaaaatat
gggaatgtcaccaaagaagttattgtcttatatctgactctgtgtaaacagtgccaccag
aagaacccagtacccaagagaggccttgcaccaaagcccatgacttttaaggacatagac
tccacatgccaagttgaaatacttgacatgcagtccagtgccgatggtgagttcaagttc
attttatactaccaggatcactcaaccaagtttattattttacggccattaagaaccaaa
caggcccatgaggtggtcagtgtcttgttagatattttcacaattcttggtacacccagt
gtgttagactctgacagtggcgttgagttcacaaaccaggttgttcatgagctcaatgag
ttgtggccagacctaaagattgtatctggtaagtaccaccctggccaaagccagggctcc
ctggaaggagcaagccgtgatgtaaagaacatgataagtacctggatgcagagtaaccac
tcatgtcactgggccaaaggcctccgattcatgcagatggtgaggaatcaggctttcgac
gtttccttgcagcaaagtccatttgaggcaatgtttggctataaagccaaatttgggcta
tattcctcaaacttgccccgggaaactgtggctactttacaaacggaagaagagctagaa
attgctgaagaacagctagaaaatagcctttggatcaggcaggaagaaagggctgagatt
ggagcagacagatctgatatggacgatgacatggatcccactcctgaagcttcagaaccc
agcacctcacaagggacttccggtctcctctgctggtga

DBGET integrated database retrieval system