KEGG   Homo sapiens (human): 124773
Entry
124773            CDS       T01001                                 
Symbol
C17orf64
Name
(RefSeq) chromosome 17 open reading frame 64
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4208
Other DBs
NCBI-GeneID: 124773
NCBI-ProteinID: NP_859058
HGNC: 26990
Ensembl: ENSG00000141371
Pharos: Q86WR6(Tdark)
UniProt: Q86WR6
Position
17:60421214..60431426
AA seq 236 aa
MEASDGQGGEGDKPLEQVTNVSCLETSSSASPARDSLMRHAKGLDQDTFKTCKEYLRPLK
KFLRKLHLPRDLPQKKKLKYMKQSLVVLGDHINTFLQHYCQAWEIKHWRKMLWRFISLFS
ELEAKQLRRLYKYTKSSQPAKFLVTFCASDAPERSLLADREDSLPKLCHAWGLHSNISGM
KERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETEP
NT seq 711 nt   +upstreamnt  +downstreamnt
atggaggcctcagatgggcaagggggtgaaggggacaagccactagagcaggtgacaaat
gtgtcatgcctggagacaagctccagcgccagccctgctagagactcgctcatgcgccat
gccaagggcctggatcaggacaccttcaaaacttgtaaagaatacctaagaccgctgaag
aagttcctgcgaaagttgcacctgcccagggaccttccccagaagaagaagctgaagtac
atgaagcagagccttgtggtcctaggggaccacatcaacacctttctgcagcattactgc
caagcctgggaaatcaaacactggagaaagatgctctggcggttcatctccctcttctcg
gagctggaagcaaagcagcttcgccgactttacaagtacaccaagagcagccagccggcc
aagttcctggtgacattctgcgcctcggatgcgccggagaggtccttgctggccgaccgg
gaagacagtctgcccaagctctgccatgcatgggggctgcacagcaacatcagcggcatg
aaggagcggctgtccaacatgcagaccccaggtcaagggagccccctgcctgggcagcca
agatcccaggaccatgtcaagaaagattctttaagggagctttctcaaaaaccaaaactc
aagaggaagaggataaaggaagccccagaaactccagagactgaaccgtaa

DBGET integrated database retrieval system