KEGG   Homo sapiens (human): 124817
Entry
124817            CDS       T01001                                 
Symbol
CNTD1, CNTD, COSA1
Name
(RefSeq) cyclin N-terminal domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 124817
NCBI-ProteinID: NP_775749
OMIM: 618166
HGNC: 26847
Ensembl: ENSG00000176563
Pharos: Q8N815(Tdark)
UniProt: Q8N815
Position
17:42798785..42811587
AA seq 330 aa
MDGPMRPRSASLVDFQFGVVATETIEDALLHLAQQNEQAVREASGRLGRFREPQIVEFVF
LLSEQWCLEKSVSYQAVEILERFMVKQAENICRQATIQPRDNKRESQNWRALKQQLVNKF
TLRLVSCVQLASKLSFRNKIISNITVLNFLQALGYLHTKEELLESELDVLKSLNFRINLP
TPLAYVETLLEVLGYNGCLVPAMRLHATCLTLLDLVYLLHEPIYESLLRASIENSTPSQL
QGEKFTSVKEDFMLLAVGIIAASAFIQNHECWSQVVGHLQSITGIALASIAEFSYAILTH
GVGANTPGRQQSIPPHLAARALKTVASSNT
NT seq 993 nt   +upstreamnt  +downstreamnt
atggacggacccatgaggccacgatcggcctccctcgttgactttcagtttggagttgtc
gccacagagacgattgaagacgccctgcttcacttggcccagcagaatgagcaagcagtg
agggaggcttcggggcggctgggccgcttcagggagccccagatcgtggagtttgttttt
ctcctgtctgaacaatggtgtctggagaaatctgtgagctaccaggctgtagaaatccta
gaaaggtttatggtaaaacaggcagagaacatctgcaggcaagccacaatccagccaaga
gataataagagagagtctcagaattggagggctctgaaacagcagcttgtcaacaagttt
actctccgtcttgtgtcatgtgttcagctggccagcaaactttccttccgaaacaaaata
atcagcaacattacagtcttgaatttcctccaggctctaggctatctacacactaaagaa
gaactgctggaatcagagcttgatgttttgaagtccttgaacttccgaattaatctgccc
actcccctggcatatgtggagacgctcctagaggttttaggatacaatggctgtttggtt
ccagccatgaggctgcatgcaacctgcctgacactgctcgacctggtctatcttctgcat
gaacccatatatgagagcctgttgagggcttcaattgagaactccactcccagtcagctg
caaggggaaaagtttacttcagtgaaggaagacttcatgctgttggcagtaggaatcatt
gcagcaagtgctttcatccaaaaccatgagtgttggagccaggttgtggggcatttgcag
agcatcactggtattgccttggcaagcattgctgagttctcttatgcaatcctgactcac
ggagtgggagccaacactccggggagacagcagtctattcctccccacctggcagccaga
gctctgaagactgttgcttcctctaacacatga

DBGET integrated database retrieval system