KEGG   Homo sapiens (human): 124944
Entry
124944            CDS       T01001                                 
Symbol
C17orf49, BAP18, HEPIS
Name
(RefSeq) chromosome 17 open reading frame 49
  KO
K23406  chromatin complexes subunit BAP18
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    124944 (C17orf49)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRF complex
    124944 (C17orf49)
SSDB
Motif
Pfam: Myb_DNA-bind_7 Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 124944
NCBI-ProteinID: NP_777553
OMIM: 617215
HGNC: 28737
Ensembl: ENSG00000258315
Pharos: Q8IXM2(Tdark)
UniProt: Q8IXM2
Position
17:7014782..7017520
AA seq 172 aa
MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDD
LNHISCVIKERTVAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSS
SSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgacgtcagcgtccacaaaggtcggagagatcttctcggcggccggcgccgccttcacg
aagctcggggagctgacgatgcagctgcatcccgtggccgactcttctcctgcgggtgcg
aagtggacggagacggaaatagagatgctgagggctgctgtgaagcgatttggggacgat
cttaatcacatcagctgtgtcatcaaggaacggacagtggcccagataaaggccactgtg
aaacgcaaggtatatgaagattctggcatcccccttccagctgagtcacccaagaaaggg
cccaagaaggtggcatctggtgtcttgtcacctcctccagctgcccctcctcccagcagc
tccagtgtccctgaggccgggggtccccccataaagaaacagaaggctgatgtgacactc
agtgctctgaacgactccgatgccaacagtgacgtggtggatattgaagggctaggagaa
actcctccagctaagaaactcaacttcgaccaggcctga

DBGET integrated database retrieval system