KEGG   Homo sapiens (human): 124975Help
Entry
124975            CDS       T01001                                 

Gene name
GGT6
Definition
(RefSeq) gamma-glutamyltransferase 6
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00430  Taurine and hypotaurine metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Drug target
Acivicin: D02755
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    124975 (GGT6)
   00480 Glutathione metabolism
    124975 (GGT6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    124975 (GGT6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     124975 (GGT6)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione hydrolase
     124975 (GGT6)
Peptidases [BR:hsa01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   124975 (GGT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 124975
NCBI-ProteinID: NP_001116362
OMIM: 612341
HGNC: 26891
Ensembl: ENSG00000167741
Vega: OTTHUMG00000177827
Pharos: Q6P531(Tdark)
UniProt: Q6P531 Q6ZPD7
Position
17p13.2
AA seq 493 aa AA seqDB search
MERAEEPVVYQKLLPWEPSLESEEEVEEEETSEALVLNPRRHQDSSRNKAGGLPGTWARV
VAALLLLAVGCSLAVRQLQNQGRSTGSLGSVAPPPGGHSHGPGVYHHGAIISPAGRELLV
AGGNVVDAGVGAALCLAVVHPHATGLGAMFWGLFHDSSSGNSTALTSGPAQTLAPGLGLP
AALPTLHLLHARFGRLPWPRLLVGPTTLAQEGFLVDTPLARALVARGTEGLCPLLCHADG
TPLGAGARATNPQLAAVLRSAALAPTSDLAGDALLSLLAGDLGVEVPSAVPRPTLEPAEQ
LPVPQGILFTTPSPSAGPELLALLEAALRSGAPIPDPCPPFLQTAVSPESSALAAVDSSG
SVLLLTSSLNCSFGSAHLSPSTGVLLSNLVAKSTTSAWACPLILRGSLDDTEADVLGLVA
SGTPDVARAMTHTLLRHLAARPPTQAQHQHQGQQEPTEHPSTCGQGTLLQVAAHTEHAHV
SSVPHACCPFQGF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggcagaagagcccgtggtctatcagaagctgctgccctgggagccaagcttg
gagtcggaggaggaagtggaggaggaggagacatcagaggcgctggttctaaacccccgg
aggcaccaggactcttccaggaacaaggctggcgggctgcccggaacctgggcccgtgta
gtggcagccctgctgctgctggctgttggctgctccctggctgtgaggcagctccagaat
cagggcaggtcgacaggaagcttgggctctgtggcccctccacccggcggacactcccac
ggccctggcgtataccaccacggtgccatcatcagccctgcaggccgagagctgcttgtt
gccgggggcaacgtcgtggatgctggagttggagctgcattgtgcctggcagtggtgcat
cctcatgccacggggctaggtgccatgttttggggcctcttccacgatagctcctcaggc
aattccacggccctgacatcaggcccagcacagaccctggcccccggcctggggctgccc
gcggctctgcccaccctgcacctgctgcatgcacgcttcggccgcctgccctggccacgc
ctgctagtgggccccaccacgctggctcaggagggcttcctggtggacacacccctggca
agggctctggtggctcggggcacagaaggcctctgtccactactttgccatgctgatggg
acacccctgggcgctggggcccgagccaccaacccacaactggcagctgtgcttcgcagc
gcagccctcgctcccacctcagaccttgctggggatgctctactgagtctactggcggga
gacctgggggtggaggtgccctcggctgtgcccaggcccactttggaaccagcagagcag
ctacctgtgccccagggcatcctgttcaccacccccagtccctcagctggcccagaactg
ctggcactgttggaggcagccctgcgctccggggcgcccatccctgacccctgcccaccg
ttcctgcagactgctgtgagccccgagagcagtgccctggccgccgtggacagcagcggc
tctgtgctccttctcacctcctcgctcaactgctcctttggctctgcacacctgtcccca
agcactggggttctgctcagcaacctggtggccaagtctaccactagtgcctgggcctgc
cccctcatcctccgtggcagcctggatgacacagaggctgatgtgttggggcttgtggct
tcagggacccctgatgtggccagggccatgactcacaccctactcaggcatctggcagca
aggccccctacccaggcccagcaccagcatcagggtcagcaagaaccaacagagcatccc
agcacttgtggccaagggaccctgctccaggtggcagcccacacagagcacgcccatgtc
tccagtgtcccccatgcctgctgccccttccaggggttctaa

DBGET integrated database retrieval system