KEGG   Homo sapiens (human): 124976
Entry
124976            CDS       T01001                                 

Symbol
SPNS2, DFNB115, SLC62A2, SLC63A2
Name
(RefSeq) sphingolipid transporter 2
  KO
K23677  MFS transporter, Spinster family, sphingosine-1-phosphate transporter
Organism
hsa  Homo sapiens (human)
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    124976 (SPNS2)
Transporters [BR:hsa02000]
 Major facilitator superfamily (MFS)
  Lipid transporters
   Sphingosine-1-phosphate transporter (Spinster) family [TC:2.A.1.49]
    124976 (SPNS2)
SSDB
Motif
Pfam: MFS_1 Sugar_tr OATP
Other DBs
NCBI-GeneID: 124976
NCBI-ProteinID: NP_001118230
OMIM: 612584
HGNC: 26992
Ensembl: ENSG00000183018
Vega: OTTHUMG00000177739
Pharos: Q8IVW8(Tbio)
UniProt: Q8IVW8
Position
17p13.2
AA seq 549 aa
MMCLECASAAAGGAEEEEADAERRRRRRGAQRGAGGSGCCGARGAGGAGVSAAGDEVQTL
SGSVRRAPTGPPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
TVAGVLLDIQQHFGVKDRGAGLLQSVFICSFMVAAPIFGYLGDRFNRKVILSCGIFFWSA
VTFSSSFIPQQYFWLLVLSRGLVGIGEASYSTIAPTIIGDLFTKNTRTLMLSVFYFAIPL
GSGLGYITGSSVKQAAGDWHWALRVSPVLGMITGTLILILVPATKRGHADQLGDQLKART
SWLRDMKALIRNRSYVFSSLATSAVSFATGALGMWIPLYLHRAQVVQKTAETCNSPPCGA
KDSLIFGAITCFTGFLGVVTGAGATRWCRLKTQRADPLVCAVGMLGSAIFICLIFVAAKS
SIVGAYICIFVGETLLFSNWAITADILMYVVIPTRRATAVALQSFTSHLLGDAGSPYLIG
FISDLIRQSTKDSPLWEFLSLGYALMLCPFVVVLGGMFFLATALFFVSDRARAEQQVNQL
AMPPASVKV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgatgtgcctggaatgcgcctcggcggcggcgggcggcgcggaggaggaggaggcggac
gcggagcggcggcgccggcgccggggggcgcagcgaggggctggcggtagcggttgctgc
ggggcgcggggcgcgggcggcgctggagtctcggccgcgggcgatgaggtgcagacgctg
tcgggcagcgtaaggcgggccccgaccggaccccccggcacccccggcacccccggctgc
gcagctactgcaaagggccccggcgctcagcagcccaaaccggccagcttgggccgcggg
cggggggcagccgccgccatcctcagcttgggcaacgtgctcaactacctggacaggtac
accgtggcaggcgtccttctggacatccagcagcactttggggtcaaggaccgaggcgcc
ggcctgctgcagtcagtgttcatctgtagcttcatggtggctgcccccatcttcggctac
ctgggcgaccgcttcaacaggaaggtgattctcagctgcggcattttcttctggtcggcc
gtcaccttctccagctccttcattccccagcagtacttctggctgctggtcctgtcccgg
gggctggtgggcatcggggaggccagctactccaccatcgcccccactatcattggcgac
ctcttcaccaagaacacgcgtacgctcatgctgtccgtcttctacttcgccatcccactg
ggcagtggcctgggctacattactggctccagcgtgaagcaggcagccggagactggcac
tgggcattgcgggtgtcccctgtcctgggcatgatcacaggaacactcatcctcattctg
gtcccagccactaaaaggggtcatgccgaccagctcggggaccagctcaaggcccggacc
tcatggctccgagatatgaaggccctgattcgaaaccgcagctacgtcttctcctccctg
gccacgtcggctgtctccttcgccacgggggccctgggcatgtggatcccgctctacctg
caccgcgcccaagttgtgcagaagacagcagagacgtgcaacagcccgccctgtggggcc
aaggacagcctcatctttggggccatcacctgctttacgggatttctgggcgtggtcacg
ggggcaggagccacgcgctggtgccgcctgaagacccagcgggccgacccactggtgtgt
gccgtgggcatgctgggctctgccatcttcatctgcctgatcttcgtggctgccaagagc
agcatcgtaggagcctatatctgtatcttcgtcggggagacgctgctgttttctaactgg
gccatcactgcagacatcctcatgtacgtggtcatccccacgcggcgcgccactgccgtg
gccttgcagagcttcacctcccacctgctgggggacgccgggagcccctacctcattggc
tttatctcagacctgatccgccagagcactaaggactccccgctctgggagttcctgagc
ctgggctacgcgctcatgctctgccctttcgtcgtggtcctgggcggcatgttcttcctc
gccactgcgctcttcttcgtcagcgaccgcgccagggctgagcagcaggtgaaccagctg
gcgatgccgcccgcatctgtgaaagtctga

DBGET integrated database retrieval system