KEGG   Homo sapiens (human): 125Help
Entry
125               CDS       T01001                                 

Gene name
ADH1B, ADH2, HEL-S-117
Definition
(RefSeq) alcohol dehydrogenase 1B (class I), beta polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Disease
H01611  Alcohol dependence
Drug target
Fomepizole: D00707
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    125 (ADH1B)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    125 (ADH1B)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    125 (ADH1B)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    125 (ADH1B)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    125 (ADH1B)
   00982 Drug metabolism - cytochrome P450
    125 (ADH1B)
 09160 Human Diseases
  09161 Cancers: Overview
   05204 Chemical carcinogenesis
    125 (ADH1B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     125 (ADH1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 125
NCBI-ProteinID: NP_000659
OMIM: 103720
HGNC: 250
Ensembl: ENSG00000196616
Vega: OTTHUMG00000161413
Pharos: P00325(Tclin)
UniProt: P00325 V9HW50
Structure
PDB: 

Position
4q23
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDHVVSGNLVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNP
RGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQ
NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggaggtaaagaaa
cccttttccattgaggatgtggaggttgcacctcctaaggcttatgaagttcgcattaag
atggtggctgtaggaatctgtcacacagatgaccacgtggttagtggcaacctggtgacc
ccccttcctgtgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagagtttgtaaaaacccggagagcaactactgcttgaaaaatgatctaggcaatcct
cgggggaccctgcaggatggcaccaggaggttcacctgcagggggaagcccattcaccac
ttccttggcaccagcaccttctcccagtacacggtggtggatgagaatgcagtggccaaa
attgatgcagcctcgcccctggagaaagtctgcctcattggctgtggattctcgactggt
tatgggtctgcagttaacgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctgttatgggctgtaaagcagctggagcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccattcaggaagtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagcgtcatcgtaggggtacctcctgcttcccag
aacctctcaataaaccctatgctgctactgactggacgcacctggaagggggctgtttat
ggtggctttaagagtaaagaaggtatcccaaaacttgtggctgattttatggctaagaag
ttttcactggatgcgttaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccgtcctgacgttttga

DBGET integrated database retrieval system