KEGG   Homo sapiens (human): 125950Help
Entry
125950            CDS       T01001                                 

Gene name
RAVER1
Definition
(RefSeq) ribonucleoprotein, PTB binding 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1
Motif
Other DBs
NCBI-GeneID: 125950
NCBI-ProteinID: NP_597709
OMIM: 609950
HGNC: 30296
Ensembl: ENSG00000161847
Vega: OTTHUMG00000180409
Pharos: Q8IY67(Tbio)
UniProt: Q8IY67 E9PAU2
Structure
PDB: 

Position
19p13.2
AA seq 739 aa AA seqDB search
MAADVSVTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFRNRRK
ILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRLRE
RELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEY
MKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCR
ALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEAQQQADGLSLGGSHLRVSFCAPG
PPGRSMLAALIAAQATALNRGKGLLPEPNILQLLNNLGPSASLQLLLNPLLHGSAGGKQG
LLGAPPAMPLLNGPALSTALLQLALQTQGQKKPGILGDSPLGALQPGAQPANPLLGELPA
GGGLPPELPPRRGKPPPLLPSVLGPAGGDREALGLGPPAAQLTPPPAPVGLRGSGLRGLQ
KDSGPLPTPPGVSLLGEPPKDYRIPLNPYLNLHSLLPASNLAGKEARGWGGAGRSRRPAE
GPPTNPPAPGGGSSSSKAFQLKSRLLSPLSSARLPPEPGLSDSYSFDYPSDMGPRRLFSH
PREPALGPHGPSRHKMSPPPSGFGERSSGGSGGGPLSHFYSGSPTSYFTSGLQAGLKQSH
LSKAIGSSPLGSGEGLLGLSPGPNGHSHLLKTPLGGQKRSFAHLLPSPEPSPEGSYVGQH
SQGLGGHYADSYLKRKRIF
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggacgtgtccgttactcaccggcccccgctgagccctaagtctggggccgaa
gtcgaagccggcgatgccgcggagcgccgggcgccggaagaagagctgccgcctctagat
ccagaagagatccggaaacgcctggaacacaccgagcgccagttccgtaaccgccgcaag
atactgatccggggcctcccgggggacgtgaccaaccaggaagtacatgacctgctcagt
gactatgagctcaaatactgttttgtggacaaatacaaagggacagccttcgtgaccctg
ctgaatggggagcaggccgaggccgcaatcaatgctttccaccagagccgcctgcgggag
cgtgaactgtcggtgcagctgcagcccacggatgccctgctgtgtgtggccaacctgccc
cccagcctcacacagcagcagttcgaggagctggtgcggcccttcggcagcctggagcgc
tgcttcctggtctacagtgagcgcactggccaatccaagggctatggctttgctgagtac
atgaagaaggactcggctgcccgtgccaagtcggacctgctgggcaagccgctgggacca
cgcaccctctacgtgcactggacggatgccgggcaactgacgcctgcccttctccactcc
cgctgcctctgtgtggaccgcctgccacctggcttcaacgatgtggacgctctgtgccgg
gcgctgtcagctgtccacagccccaccttctgccagctggcgtgcggccaggatgggcag
ctgaagggcttcgcggtgctggagtatgagacggctgagatggcggaggaggcacagcag
caggcggacggcctgtccctggggggcagccacctgcgagtctccttctgcgcccctggg
ccccccggccgcagtatgctggccgctctcatcgctgcccaggccacggccctcaatcgg
gggaagggactcctccccgagcccaacatcctgcagctgctcaacaacctgggcccatcc
gcgtccctccagctgctgctcaaccccctgctccatggcagtgcgggggggaagcagggc
ctcctgggtgcccccccagccatgccgctgctcaatgggccagccctgtccacggcgctg
ttgcagctcgccctgcagacccagggccagaagaagcccggcatcctgggagactcaccc
ctgggcgccctccagcctggggcccagccagccaaccccctcctcggggagctgcctgca
ggagggggcctgcccccggagctgccgccccggcgagggaagccaccacccctgctgcca
tccgtgcttggccctgctgggggtgaccgggaggccctgggcttgggtcccccagcggcc
cagctcactcctccccccgcccctgtggggctccgaggctctggcctcagaggcctccag
aaagacagtgggcctctgccgacgccccctggggtctcactgctgggggagccccccaag
gactaccggattcccctgaatccctacctgaacctacacagcctgctcccggccagcaac
ctggcgggtaaggaggcccggggctggggaggcgccgggagaagccgccgcccagctgag
ggccccccaactaaccccccagcccctggaggtggcagcagcagcagcaaagccttccag
ctcaagtcccgcctgctcagccccctcagcagcgcccgcctgccccccgaaccaggactg
tctgacagctacagcttcgactacccctcggacatgggacctcggcggctcttctcccac
ccacgggaaccagcccttgggcctcacggacccagccgacacaagatgtcccccccgccc
agtggcttcggcgaacggagcagcggtgggagtggcgggggccccctgtctcacttctat
tcaggctcgcccacttcctacttcaccagcggcctgcaggctggcctcaagcagagccac
ctcagtaaggcaatcggctcttccccgctggggtccggagaagggctcctgggcctcagc
cccgggcctaatggtcacagccacctgctgaagaccccactgggcggccagaaacgcagc
tttgcccacctgctgccctcgcccgagcccagcccagaaggcagctatgtgggccagcac
tcccagggcctcggcggccactacgcggactcctacctgaagcggaagaggattttctaa

DBGET integrated database retrieval system