KEGG   Homo sapiens (human): 125965
Entry
125965            CDS       T01001                                 
Symbol
COX6B2, COXVIB2, CT59
Name
(RefSeq) cytochrome c oxidase subunit 6B2
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    125965 (COX6B2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    125965 (COX6B2)
  09159 Environmental adaptation
   04714 Thermogenesis
    125965 (COX6B2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    125965 (COX6B2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    125965 (COX6B2)
   05012 Parkinson disease
    125965 (COX6B2)
   05014 Amyotrophic lateral sclerosis
    125965 (COX6B2)
   05016 Huntington disease
    125965 (COX6B2)
   05020 Prion disease
    125965 (COX6B2)
   05022 Pathways of neurodegeneration - multiple diseases
    125965 (COX6B2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    125965 (COX6B2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    125965 (COX6B2)
SSDB
Motif
Pfam: COX6B CX9C 7tm_7
Other DBs
NCBI-GeneID: 125965
NCBI-ProteinID: NP_653214
OMIM: 618127
HGNC: 24380
Ensembl: ENSG00000160471
Pharos: Q6YFQ2(Tdark)
UniProt: Q6YFQ2
Position
19:complement(55349704..55354719)
AA seq 88 aa
MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYF
RVYHSLCPISWVESWNEQIKNGIFAGKI
NT seq 267 nt   +upstreamnt  +downstreamnt
atgttggatgtggaagcccaggagccccccaaggggaaatggtcgacgccgcccttcgac
ccgcgcttccccagccagaaccagatccgtaactgctaccagaacttcctggactaccac
cgctgcctcaagaccaggacccgccgcgggaagagcacgcagccctgcgagtactatttc
cgcgtgtaccactcgctgtgccccatcagctgggtggagagctggaacgagcagatcaag
aacgggattttcgccggcaaaatctga

DBGET integrated database retrieval system