KEGG   Homo sapiens (human): 125981Help
Entry
125981            CDS       T01001                                 

Gene name
ACER1, ALKCDase1, ASAH3
Definition
(RefSeq) alkaline ceramidase 1
  KO
K01441  alkaline ceramidase [EC:3.5.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    125981 (ACER1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    125981 (ACER1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     125981 (ACER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ceramidase
Motif
Other DBs
NCBI-GeneID: 125981
NCBI-ProteinID: NP_597999
OMIM: 613491
HGNC: 18356
Ensembl: ENSG00000167769
Vega: OTTHUMG00000180777
Pharos: Q8TDN7(Tbio)
UniProt: Q8TDN7
Position
19p13.3
AA seq 264 aa AA seqDB search
MPSIFAYQSSEVDWCESNFQYSELVAEFYNTFSNIPFFIFGPLMMLLMHPYAQKRSRYIY
VVWVLFMIIGLFSMYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGNRSQF
IRLVFITTVVSTLLSFLRPTVNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLW
AVALTSWISDRLLCSFWQRIHFFYLHSIWHVLISITFPYGMVTMALVDANYEMPGETLKV
RYWPRDSWPVGLPYVEIRGDDKDC
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcatcttcgcctatcagagctccgaggtggactggtgtgagagcaacttccag
tactcggagctggtggccgagttctacaacacgttctccaatatccccttcttcatcttc
gggccactgatgatgctcctgatgcacccgtatgcccagaagcgctcccgctacatttac
gttgtctgggtcctcttcatgatcataggcctgttctccatgtatttccacatgacgctc
agcttcctgggccagctgctggacgagatcgccatcctgtggctcctgggcagtggctat
agcatatggatgccccgctgctatttcccctccttccttggggggaacaggtcccagttc
atccgcctggtcttcatcaccactgtggtcagcacccttctgtccttcctgcggcccacg
gtcaacgcctacgccctcaacagcattgccctgcacattctctacatcgtgtgccaggag
tacaggaagaccagcaataaggagcttcggcacctgattgaggtctccgtggttttatgg
gctgttgctctgaccagctggatcagtgaccgtctgctttgcagcttctggcagaggatt
catttcttctatctgcacagcatctggcatgtgctcatcagcatcaccttcccttatggc
atggtcaccatggccttggtggatgccaactatgagatgccaggtgaaaccctcaaagtc
cgctactggcctcgggacagttggcccgtggggctgccctacgtggaaatccggggtgat
gacaaggactgctga

DBGET integrated database retrieval system