KEGG   Homo sapiens (human): 126014
Entry
126014            CDS       T01001                                 
Symbol
OSCAR, PIGR3, PIgR-3
Name
(RefSeq) osteoclast associated Ig-like receptor
  KO
K14377  osteoclast-associated immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    126014 (OSCAR)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 126014
NCBI-ProteinID: NP_001269278
OMIM: 606862
HGNC: 29960
Ensembl: ENSG00000170909
Pharos: Q8IYS5(Tbio)
UniProt: Q8IYS5
Structure
Position
19:complement(54094668..54100803)
AA seq 282 aa
MALVLILQLLTLWPLCHTDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAW
RFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDVLE
LLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWA
DFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPP
SDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV
NT seq 849 nt   +upstreamnt  +downstreamnt
atggccctggtgctgatcctccagctgctgaccctctggcctctgtgtcacacagacatc
actccgtctgtccccccagcttcataccaccctaagccatggctgggagctcagccggct
acagttgtgacccctggggtcaacgtgaccttgagatgccgggcaccccaacccgcttgg
agatttggacttttcaagcctggagagatcgctccccttctcttccgggatgtgtcctcc
gagctggcagaattctttctggaggaggtgactccagcccaagggggaagttaccgctgc
tgctaccgaaggccagactgggggccgggtgtctggtcccagcccagcgatgtcctggag
ctgctggtgacagaggagctgccgcggccgtcgctggtggcgctgcccgggccggtggtg
ggtcctggcgccaacgtgagcctgcgctgcgcgggccgcctgcggaacatgagcttcgtg
ctgtaccgcgagggcgtggcggccccgctgcagtaccgccactccgcgcagccctgggcc
gacttcacgctgctgggcgcccgcgcccccggcacctacagctgctactatcacacgccc
tccgcgccctacgtgctgtcgcagcgcagcgaggtgctggtcatcagctgggaaggtgag
ggccctgaggcccggcccgcctcctccgccccaggaatgcaggccccaggacctccgccc
tcagacccaggagcccaggcccccagcctctcctccttcagacccaggggtctagtcctg
cagcccctcctccctcagacccaggattcctgggacccagcccctcctccctcagatcca
ggagtctag

DBGET integrated database retrieval system