KEGG   Homo sapiens (human): 126068Help
Entry
126068            CDS       T01001                                 

Gene name
ZNF441
Definition
(RefSeq) zinc finger protein 441
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 KRAB zf-C2H2_6 zf-C2H2_jaz Zn_ribbon_SprT Zn-ribbon_8 zf-met MASE2 zf-C2H2_11 XPA_N
Motif
Other DBs
NCBI-GeneID: 126068
NCBI-ProteinID: NP_689568
HGNC: 20875
Ensembl: ENSG00000197044
Vega: OTTHUMG00000154449
Pharos: Q8N8Z8(Tdark)
UniProt: Q8N8Z8
Position
19p13.2
AA seq 693 aa AA seqDB search
MDSVAFEDVAINFTCEEWALLGPSQKSLYRDVMQETIRNLDCIGMIWQNHDIEEDQYKDL
RRNLRCHMVERACEIKDNSQCGGPFTQTQDSIVNEKIPGVDPWESSECTDVLMGRSSLNC
YVRVDSEHKPCEYQEYGEKPYTHTQCGTAFSYQPCFQIHERPQHGKKLYDCKECASFSSL
ENLQRHMAAHHGDGPRICKLCGNAFIWPSLFHMLRRTHTEEKPYEYEQCSTAFPAYSSTL
RHERTHSGEKPYQCKQCGKAFSCSCYTQLYERTHTGEQSYECKQCGKAFYHLGSFQRHMI
VHTGDGPHKCKICGKGFLSPSSVRRHKRTHTGEKPYECKYCGKAFSDCTGFRRHMITHTG
DGPHKCKVCGKAFDSPSLCRRHETTHTGEKPYKCECGKAFSDFYYFRNHETTHTGEKPYK
CKQCGKAFICCTYLQIHERIHTGERPYKCKQCGKAFRSSNYIRVHEKTHTGEKPYECKQC
GKALSHLKSFQRHMIMHTGDGPHKCKICGKSFDSPSSFRRHERIHTGERPYKCKLCGKGF
RSSSYIQLHERTHTGEKPYGCQQCGKALSDLSSFRRHMITHTGNGPHKCKICGKGFDYPS
SVQRHERTHTGEKPYECKECGKAFSHSSYLRIHERVHTGEKPYKCKECGKPFHCPSAFHK
HERTHSMEKPYKCKECGEAFHCISSFHKHEMTH
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggactcagtggcatttgaggatgtggctataaacttcacctgtgaggagtgggctttg
ctgggtccatcacagaagagtctctacagagatgtgatgcaggaaaccatcagaaacctg
gactgtataggaatgatatggcaaaatcatgatatagaagaagatcagtacaaagatctc
agaagaaatctaagatgtcatatggtagagagagcctgtgaaattaaagataatagtcaa
tgtggaggaccctttacccagactcaagacagtattgtgaacgagaaaatacctggagta
gatccatgggaaagcagtgagtgtacagacgtcctcatgggtcgttcatctcttaattgc
tacgttagagttgacagtgaacacaaaccatgtgagtatcaagaatatggagagaagcca
tatacacatacacaatgtgggacagctttcagttatcagccctgctttcaaatacatgaa
agacctcagcatggaaagaaactctatgattgtaaggaatgtgcaagcttcagttctctt
gaaaaccttcaaagacacatggcagcacaccatggagatggacctcgtatatgtaagttg
tgtggaaacgcctttatttggcctagtttatttcatatgcttagaagaactcacactgaa
gagaaaccatatgaatatgagcagtgttctacagcgtttcctgcttatagttccactcta
agacatgaaagaacacacagtggagagaaaccctatcaatgtaaacaatgtgggaaagcc
ttcagttgttcctgttacactcaactatatgaaaggactcacactggagaacaatcctat
gaatgtaagcaatgtgggaaagcattttatcatcttggaagctttcaaagacacatgata
gtgcacactggagatgggcctcataaatgtaagatatgtggaaaaggctttctttctccc
agttcagttcgaagacataaaagaactcacactggagagaaaccgtatgaatgtaagtat
tgtgggaaagcattctctgattgcacaggttttcgaagacacatgataacgcacactgga
gatggacctcataaatgcaaggtatgtgggaaagcctttgattctcccagtttatgtcga
aggcatgaaacaactcatactggggagaaaccctataaatgtgaatgtgggaaagccttt
agtgatttctattactttcgaaatcatgaaactactcacactggagagaagccatataaa
tgtaaacaatgtggaaaagccttcatttgttgcacttaccttcaaatacatgaaagaatt
cacactggggagagaccctataaatgtaaacaatgcggaaaagccttcaggtcttccaat
tacattcgagtacatgaaaagactcacactggagaaaagccctatgaatgtaagcagtgt
ggaaaagcactttctcatctgaaaagctttcagagacacatgataatgcacactggagat
ggacctcataaatgtaagatatgtgggaaaagctttgattctcccagttcatttcgaaga
catgaaagaattcacactggggagagaccctataagtgtaaactatgtgggaaaggcttc
aggtcttccagttacattcaactacatgaaaggactcacactggagagaaaccctatggt
tgtcagcaatgtgggaaagcattatctgatctctcaagctttcgaagacacatgataaca
catactggaaatggacctcataaatgtaagatatgtgggaaaggctttgattatcccagt
tcagtgcaaagacatgaaagaactcacactggagagaaaccctatgaatgcaaggaatgt
ggtaaagccttcagtcattcaagttacttacgaatacacgaaagagttcatactggagag
aagccgtataaatgtaaggaatgtgggaaaccattccattgtcccagtgcctttcataaa
catgaaaggacccacagtatggagaaaccctataagtgtaaagaatgtggggaagcattt
cattgtatcagttcctttcataaacatgaaatgactcactag

DBGET integrated database retrieval system