KEGG   Homo sapiens (human): 126070Help
Entry
126070            CDS       T01001                                 

Gene name
ZNF440
Definition
(RefSeq) zinc finger protein 440
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    126070 (ZNF440)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    126070 (ZNF440)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    126070 (ZNF440)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 KRAB zf-C2H2_jaz zf-C2H2_6 zf-met Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 126070
NCBI-ProteinID: NP_689570
HGNC: 20874
Ensembl: ENSG00000171295
Vega: OTTHUMG00000156403
Pharos: Q8IYI8(Tdark)
UniProt: Q8IYI8
Position
19p13.2
AA seq 595 aa AA seqDB search
MDPVAFKDVAVNFTQEEWALLDISQRKLYREVMLETFRNLTSLGKRWKDQNIEYEHQNPR
RNFRSLIEEKVNEIKDDSHCGETFTPVPDDRLNFQEKKASPEVKSCESFVCGEVGLGNSS
FNMNIRGDIGHKAYEYQEYGPKPCKCQQPKKAFRYRPSFRTQERDHTGEKPNACKVCGKT
FISHSSVRRHMVMHSGDGPYKCKFCGKAFHCLRLYLIHERIHTGEKPCECKQCGKSFSYS
ATHRIHKRTHTGEKPYEYQECGKAFHSPRSYRRHERIHMGEKAYQCKECGKAFTCPRYVR
IHERTHSRKNLYECKQCGKALSSLTSFQTHVRLHSGERPYECKICGKDFCSVNSFQRHEK
IHSGEKPYKCKQCGKAFPHSSSLRYHERTHTGEKPYECKQCGKAFRSASHLRVHGRTHTG
EKPYECKECGKAFRYVNNLQSHERTQTHIRIHSGERRYKCKICGKGFYCPKSFQRHEKTH
TGEKLYECKQRSVVPSVVPVPFDIMKGLTLERSPINASNVGKPSELCQSFECMVGLTLKR
NPMSVSNDGKPSDLPHTFEYVVGHTMERSPMHVRNVGNPSDLPRTFEFMKGHKHT
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggacccagtggcttttaaggatgtggctgtgaacttcacccaggaggagtgggctttg
ctggatatttcccagaggaaactctacagggaagtgatgctggaaactttcaggaacctg
acctctttaggaaaaaggtggaaagaccagaacattgaatatgagcaccaaaaccccagg
agaaacttcaggagtctcatagaagaaaaagtcaatgaaattaaagatgacagtcattgt
ggagaaacttttaccccagttccagatgacagactgaacttccaggagaagaaagcttct
cctgaagtaaaatcatgtgaaagctttgtgtgtggagaagttggcctaggtaactcatct
tttaatatgaacatcagaggtgacattggacacaaggcatatgagtatcaggaatatgga
ccaaagccatgtaagtgtcaacaacctaaaaaagccttcagataccgcccctcctttaga
acacaagaaagggatcacactggagagaaacccaatgcttgtaaagtatgtggaaaaacc
tttatttcccattcaagtgttcgaagacacatggtaatgcacagtggggatggaccttat
aaatgtaagttttgtgggaaagcattccattgtctcagattatatcttatccatgaaaga
attcacactggagagaaaccatgtgaatgtaaacagtgtggtaaatcctttagttattct
gctacccatcgaatacataaaagaactcacactggagaaaagccttatgaatatcaggag
tgtgggaaagcatttcatagtcccagatcctatcgtagacatgaaaggattcacatggga
gaaaaggcttatcaatgtaaggaatgtggaaaagcattcacgtgtccccgttatgttcgt
atacatgaaaggacccactctaggaaaaatctctatgaatgtaagcagtgtgggaaagca
ttatcctctcttacaagttttcaaacacacgtaagattgcactctggagaaagaccttat
gaatgtaagatatgtggaaaagacttttgttctgtgaattcatttcaaagacatgaaaaa
attcacagtggagagaaaccctataaatgtaagcagtgtggtaaagccttccctcattcc
agttcccttcgatatcatgaaaggactcacactggagagaaaccctatgagtgtaagcaa
tgtgggaaagccttcagatctgcctcacaccttcgagtgcatggtaggactcacactgga
gagaaaccgtatgaatgtaaggaatgtgggaaagccttcagatatgtgaataaccttcaa
agtcatgaaaggacacaaacacacataagaatacactctggagaaagacgttataaatgt
aagatatgtgggaaaggcttttattgtcccaaatcatttcaaagacatgaaaaaactcac
actggagagaaactctatgaatgcaagcaacgttcagtagttccttcagtagttccagtt
ccttttgatatcatgaaaggactcacactggagagaagccctataaatgcgagcaatgtg
ggaaagccttcagagctgtgtcaatcctttgaatgcatggtaggactcaccctgaagaga
aaccctatgagtgtgagcaatgacggaaagccttcagatctgccccacacctttgaatac
gtggtaggacacacaatggagagaagccctatgcatgtaaggaatgtgggaaacccttcg
gatctgcccagaaccttcgaattcatgaaaggacacaaacacacataa

DBGET integrated database retrieval system