KEGG   Homo sapiens (human): 126074Help
Entry
126074            CDS       T01001                                 

Gene name
SWSAP1, C19orf39, SWS1AP1, ZSWIM7AP1
Definition
(RefSeq) SWIM-type zinc finger 7 associated protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT AAA_16 AAA_25 AAA AAA_19 AAA_22
Motif
Other DBs
NCBI-GeneID: 126074
NCBI-ProteinID: NP_787067
OMIM: 614536
HGNC: 26638
Ensembl: ENSG00000173928
Vega: OTTHUMG00000182025
Pharos: Q6NVH7(Tbio)
UniProt: Q6NVH7
Position
19p13.2
AA seq 250 aa AA seqDB search
MAETLRRVLTRGGAAWSGEENMPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLF
LTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLE
EYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQ
RYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSS
GKGSSSGGQP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcggagacgctgaggcgggtgctaaccaggggcggtgcggcctggtccggggaggag
aacatgcctgccgccggaccgcctttgctgctgctcggtacaccaggatctggaaaaaca
gcgctgctatttgctgcggccctagaggcggcgggggagggccaaggcccagtcctcttc
ctgacacgaaggcctcttcaaagcatgccccgcgggaccggaacgactctagacccaatg
cgactccagaagatccgcttccagtacccaccctcaacccgagagcttttccggctcctg
tgctctgcccatgaggccccggggccagccccctcccttctgctgctcgacggcctagaa
gagtacctagcggaagacccagagccccaggaagccgcctacctcattgccttacttcta
gacacagctgcccacttcagccaccggcttgggcctggccgggattgtgggctcatggtg
gccctccagacccaggaggaagcaggtagtggggacgtcctgcacctggcactgctccag
cggtattttcctgcccagtgctggctgcagccagatgcaccaggtccaggagagcacggc
ctccgagcctgcctggagccaggcgggctgggccccagaacagagtggtgggtgactttc
cgatcagatggagaaatgatgatcgctccgtggcccacccaggctggtgaccccagctca
ggcaagggttcaagctctggaggccagccctga

DBGET integrated database retrieval system