KEGG   Homo sapiens (human): 1261Help
Entry
1261              CDS       T01001                                 

Gene name
CNGA3, ACHM2, CCNC1, CCNCa, CCNCalpha, CNCG3, CNG3
Definition
(RefSeq) cyclic nucleotide gated channel subunit alpha 3
  KO
K04950  cyclic nucleotide gated channel alpha 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
Disease
H00971  Achromatopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1261 (CNGA3)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    1261 (CNGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1261 (CNGA3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1261 (CNGA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CLZ Ion_trans cNMP_binding Ion_trans_2 HAUS-augmin3
Motif
Other DBs
NCBI-GeneID: 1261
NCBI-ProteinID: NP_001289
OMIM: 600053
HGNC: 2150
Ensembl: ENSG00000144191
Vega: OTTHUMG00000130561
Pharos: Q16281(Tbio)
UniProt: Q16281
Structure
PDB: 

Position
2q11.2
AA seq 694 aa AA seqDB search
MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADS
GQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQAN
VGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSSNLYYRWLTAIALPVF
YNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLW
QHYKTTTQFKLDVLSLVPTDLAYLKVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNM
FRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSLYWST
LTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSI
KQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKV
RIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVV
LSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEE
KGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQ
RLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaacacccaatactcccacccctccaggacccacctcaaggtaaagacc
tcagaccgagatctcaatcgcgctgaaaatggcctcagcagagcccactcgtcaagtgag
gagacatcgtcagtgctgcagccggggatcgccatggagaccagaggactggctgactcc
gggcagggctccttcaccggccaggggatcgccaggctgtcgcgcctcatcttcttgctg
cgcaggtgggctgccaggcatgtgcaccaccaggaccagggaccggactcttttcctgat
cgtttccgtggagccgagcttaaggaggtgtccagccaagaaagcaatgcccaggcaaat
gtgggcagccaggagccagcagacagagggagaagcgcctggcccctggccaaatgcaac
actaacaccagcaacaacacggaggaggagaagaagacgaaaaagaaggatgcgatcgtg
gtggacccgtccagcaacctgtactaccgctggctgaccgccatcgccctgcctgtcttc
tataactggtatctgcttatttgcagggcctgtttcgatgagctgcagtccgagtacctg
atgctgtggctggtcctggactactcggcagatgtcctgtatgtcttggatgtgcttgta
cgagctcggacaggttttctcgagcaaggcttaatggtcagtgataccaacaggctgtgg
cagcattacaagacgaccacgcagttcaagctggatgtgttgtccctggtccccaccgac
ctggcttacttaaaggtgggcacaaactacccagaagtgaggttcaaccgcctactgaag
ttttcccggctctttgaattctttgaccgcacagagacaaggaccaactaccccaatatg
ttcaggattgggaacttggtcttgtacattctcatcatcatccactggaatgcctgcatc
tactttgccatttccaagttcattggttttgggacagactcctgggtctacccaaacatc
tcaatcccagagcatgggcgcctctccaggaagtacatttacagtctctactggtccacc
ttgacccttaccaccattggtgagaccccaccccccgtgaaagatgaggagtatctcttt
gtggtcgtagacttcttggtgggtgttctgatttttgccaccattgtgggcaatgtgggc
tccatgatctcgaatatgaatgcctcacgggcagagttccaggccaagattgattccatc
aagcagtacatgcagttccgcaaggtcaccaaggacttggagacgcgggttatccggtgg
tttgactacctgtgggccaacaagaagacggtggatgagaaggaggtgctcaagagcctc
ccagacaagctgaaggctgagatcgccatcaacgtgcacctggacacgctgaagaaggtt
cgcatcttccaggactgtgaggcagggctgctggtggagctggtgctgaagctgcgaccc
actgtgttcagccctggggattatatctgcaagaagggagatattgggaaggagatgtac
atcatcaacgagggcaagctggccgtggtggctgatgatggggtcacccagttcgtggtc
ctcagcgatggcagctacttcggggagatcagcattctgaacatcaaggggagcaagtcg
gggaaccgcaggacggccaacatccgcagcattggctactcagacctgttctgcctctca
aaggacgatctcatggaggccctcaccgagtaccccgaagccaagaaggccctggaggag
aaaggacggcagatcctgatgaaagacaacctgatcgatgaggagctggccagggcgggc
gcggaccccaaggaccttgaggagaaagtggagcagctggggtcctccctggacaccctg
cagaccaggtttgcacgcctcctggctgagtacaacgccacccagatgaagatgaagcag
cgtctcagccaactggaaagccaggtgaagggtggtggggacaagcccctggctgatggg
gaagttcccggggatgctacaaaaacagaggacaaacaacagtga

DBGET integrated database retrieval system