KEGG   Homo sapiens (human): 126133
Entry
126133            CDS       T01001                                 
Symbol
ALDH16A1
Name
(RefSeq) aldehyde dehydrogenase 16 family member A1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-GeneID: 126133
NCBI-ProteinID: NP_699160
OMIM: 613358
HGNC: 28114
Ensembl: ENSG00000161618
Pharos: Q8IZ83(Tdark)
UniProt: Q8IZ83
Position
19:49453225..49471050
AA seq 802 aa
MAATRAGPRAREIFTSLEYGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQ
DPITGENLASCLQAQAEDVAAAVEAARMAFKGWSAHPGVVRAQHLTRLAEVIQKHQRLLW
TLESLVTGRAVREVRDGDVQLAQQLLHYHAIQASTQEEALAGWEPMGVIGLILPPTFSFL
EMMWRICPALAVGCTVVALVPPASPAPLLLAQLAGELGPFPGILNVLSGPASLVPILASQ
PGIRKVAFCGAPEEGRALRRSLAGECAELGLALGTESLLLLTDTADVDSAVEGVVDAAWS
DRGPGGLRLLIQESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREA
QSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVEVPWPVVVASPFRTAKEALLVAN
GTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPSVPTGGCKESGCSWHGGPDG
LYEYLRPSGTPARLSCLSKNLNYDTFGLAVPSTLPAGPEIGPSPAPPYGLFVGGRFQAPG
ARSSRPIRDSSGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQSPGARAALLWALAAALE
RRKSTLASRLERQGAELKAAEAEVELSARRLRAWGARVQAQGHTLQVAGLRGPVLRLREP
LGVLAVVCPDEWPLLAFVSLLAPALAYGNTVVMVPSAACPLLALEVCQDMATVFPAGLAN
VVTGDRDHLTRCLALHQDVQAMWYFGSAQGSQFVEWASAGNLKPVWASRGCPRAWDQEAE
GAGPELGLRVARTKALWLPMGD
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggctgcgacgcgtgcagggccccgcgcccgcgagatcttcacctcgctggagtacgga
ccggtgccggagagccacgcatgcgcactggcctggctggacacccaggaccggtgcttg
ggccactatgtgaatgggaagtggttaaagcctgaacacagaaattcagtgccttgccag
gatcccatcacaggagagaacttggccagttgcctgcaggcacaggccgaggatgtggct
gcagccgtggaggcagccaggatggcatttaagggctggagtgcgcaccccggcgtcgtc
cgggcccagcacctgaccaggctggccgaggtgatccagaagcaccagcggctgctgtgg
accctggaatccctggtgactgggcgggctgttcgagaggttcgagacggggacgtccag
ctggcccagcagctgctccactaccatgcaatccaggcatccacccaggaggaggcactg
gcaggctgggagcccatgggagtaattggcctcatcctgccacccacattctccttcctt
gagatgatgtggaggatttgccctgccctggctgtgggctgcaccgtggtggccctcgtg
cccccggcctccccggcgcccctcctcctggcccagctggcgggggagctgggccccttc
ccgggaatcctgaatgtcctcagtggccctgcgtccctggtgcccatcctggcctcccag
cctggaatccggaaggtggccttctgcggagccccggaggaagggcgtgcccttcgacgg
agcctggcgggagagtgtgcggagctgggcctggcgctggggacggagtcgctgctgctg
ctgacggacacggcggacgtagactcggccgtggagggtgtcgtggacgccgcctggtcc
gaccgcggcccgggtggcctcaggctcctcatccaggagtctgtgtgggatgaagccatg
agacggctgcaggagcggatggggcggcttcggagtggccgagggctggatggggccgtg
gacatgggggcccggggggctgccgcatgtgacctggtccagcgctttgtgcgtgaggcc
cagagccagggtgcacaggtgttccaggctggtgatgtgccttcggaacgcccattctat
cccccaaccttggtctccaacctgcccccagcctccccatgtgcccaggtggaggtgccg
tggcctgtggtcgtggcctcccccttccgcacagccaaggaggcactgttggtggccaac
gggacgccccgcgggggcagcgccagtgtgtggagcgagaggctggggcaggcgctggag
ctgggctatgggctccaggtgggcactgtctggatcaacgcccacggcctcagagaccct
tcggtgcccacaggcggctgcaaggagagtgggtgttcctggcacgggggcccagacggg
ctgtatgagtatctgcggccctcagggacccctgcccggctgtcctgcctctccaagaac
ctgaactatgacacctttggcctcgctgttccctcaaccctgccggctgggcctgaaata
gggcccagcccagcacccccctatgggctcttcgttgggggccgtttccaggctcctggg
gcccgaagctccaggcccatccgggattcgtctggcaacctccatggctacgtggctgag
ggtggagccaaggacatccgaggtgctgtggaggccgctcaccaggctttccctggctgg
gcgggccagtccccaggagcccgggcagccctgctgtgggccctggcggctgcactggag
cgccggaagtctaccctggcctcgaggctggagaggcagggagcggagctcaaggctgcg
gaggcggaggtggagctgagcgcaagacgacttcgggcgtggggggcccgggtgcaggcc
caaggccacaccctgcaggtagccgggctgagaggccctgtgctgcgcctgcgggagccg
ctgggtgtgctggctgtggtgtgtccggacgagtggcccctgcttgccttcgtgtccctg
ctggctcccgccctggcctacggcaacactgtggtcatggtgcccagtgcggcctgtcct
ctgctggccctggaggtctgccaggacatggccaccgtgttcccagcaggcctggccaac
gtggtgacaggagaccgggaccatctgacccgctgcctggccttgcaccaagacgtccag
gccatgtggtatttcggatcagcccagggttcccagtttgtcgagtgggcctcggcagga
aacctcaaaccggtgtgggcgagcaggggctgcccgcgggcctgggaccaggaggccgag
ggggcaggcccagagctggggctgcgagtggcgcggaccaaggccctgtggctgcctatg
ggggactga

DBGET integrated database retrieval system