KEGG   Homo sapiens (human): 1262Help
Entry
1262              CDS       T01001                                 

Gene name
CNGA4, CNCA2, CNG-4, CNG4, CNG5, CNGB2, OCNC2, OCNCBETA, OCNCb
Definition
(RefSeq) cyclic nucleotide gated channel subunit alpha 4
  KO
K04951  cyclic nucleotide gated channel alpha 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1262 (CNGA4)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    1262 (CNGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1262 (CNGA4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1262 (CNGA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CLZ cNMP_binding
Motif
Other DBs
NCBI-GeneID: 1262
NCBI-ProteinID: NP_001032406
OMIM: 609472
HGNC: 2152
Ensembl: ENSG00000132259
Vega: OTTHUMG00000165379
Pharos: Q8IV77(Tdark)
UniProt: Q8IV77
Position
11p15.4
AA seq 575 aa AA seqDB search
MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPD
LQHGYLVAWLVLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLA
SLMPTDVVYVRLGPHTPTLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI
HWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAR
EEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPEDLAEADDEGEPEEGTSKDEEGRASQEGPPGPE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggacaccaaagtgaagacaacagagtccagtcccccagccccatccaaggcc
aggaagttgctgcctgtcctggacccatctggggattactactactggtggctgaacaca
atggtcttcccagtcatgtataacctcatcatcctcgtgtgcagagcctgcttccccgac
ttgcagcacggttatctggtggcctggttggtgctggactacacgagtgacctgctatac
ctactagacatggtggtgcgcttccacacaggattcttggaacagggcatcctggtggtg
gacaagggtaggatctcgagtcgctacgttcgcacctggagtttcttcttggacctggct
tccctgatgcccacagatgtggtctacgtgcggctgggcccgcacacacccaccctgagg
ctgaaccgctttctccgcgcgccccgcctcttcgaggccttcgaccgcacagagacccgc
acagcttacccaaatgcctttcgcattgccaagctgatgctttacatttttgtcgtcatc
cattggaacagctgcctatactttgccctatcccggtacctgggcttcgggcgtgacgca
tgggtgtacccggaccccgcgcagcctggctttgagcgcctgcggcgccagtacctctat
agcttttacttctccacgctgatactgactacagtgggcgatacaccgccgccagccagg
gaagaagagtacctcttcatggtgggcgacttcctgctggccgtcatgggtttcgccacc
atcatgggtagcatgagctctgtcatctacaacatgaacactgcagatgcggctttctac
ccagatcatgcactggtgaagaagtacatgaagctgcagcacgtcaaccgcaagctggag
cggcgagttattgactggtatcagcacctgcagatcaacaagaagatgaccaacgaggta
gccatcttacagcacttgcctgagcggctgcgggcagaagtggctgtgtctgtgcacctg
tccactctgagccgggtgcagatctttcagaactgtgaggccagcctgctggaggagctg
gtgctgaagctgcagccccagacctactcaccaggtgaatatgtatgccgcaaaggagac
attggccaagagatgtacatcatccgagagggtcaactggccgtggtggcagatgatggt
atcacacagtatgctgtgctcggtgcagggctctactttggggagatcagcatcatcaac
atcaaagggaacatgtctgggaaccgccgcacagccaacatcaagagcctaggttattca
gacctattctgcctgagcaaggaggacctgcgggaggtgctgagcgagtatccacaagca
cagaccatcatggaggagaaaggacgtgagatcctgctgaaaatgaacaagttggacgtg
aatgctgaggcagctgagatcgccctgcaggaggccacagagtcccggctacgaggccta
gaccagcagctggatgatctacagaccaagtttgctcgcctcctggctgagctggagtcc
agcgcacttaagattgcttaccgcattgaacggctggagtggcagactcgagagtggcca
atgcccgaggacctggctgaggctgatgacgagggtgagcctgaggagggaacttccaaa
gatgaagagggcagggccagccaggagggacccccaggtccagagtga

DBGET integrated database retrieval system