KEGG   Homo sapiens (human): 126205Help
Entry
126205            CDS       T01001                                 

Gene name
NLRP8, CLR19.2, NALP8, NOD16, PAN4
Definition
(RefSeq) NLR family pyrin domain containing 8
  KO
K22662  NACHT, LRR and PYD domains-containing protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    126205 (NLRP8)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   126205 (NLRP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT NLRC4_HD2 PYRIN LRR_6 NOD2_WH AAA_16 LRR_8 NB-ARC AAA AAA_22 AAA_25
Motif
Other DBs
NCBI-GeneID: 126205
NCBI-ProteinID: NP_789781
OMIM: 609659
HGNC: 22940
Ensembl: ENSG00000179709
Vega: OTTHUMG00000181754
Pharos: Q86W28(Tdark)
UniProt: Q86W28
Position
19q13.43
AA seq 1048 aa AA seqDB search
MSDVNPPSDTPIPFSSSSTHSSHIPPWTFSCYPGSPCENGVMLYMRNVSHEELQRFKQLL
LTELSTGTMPITWDQVETASWAEVVHLLIERFPGRRAWDVTSNIFAIMNCDKMCVVVRRE
INAILPTLEPEDLNVGETQVNLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQ
GVHRHEEYLPCLLLPKRPQGRQPKTVAIQGAPGIGKTILAKKVMFEWARNKFYAHKRWCA
FYFHCQEVNQTTDQSFSELIEQKWPGSQDLVSKIMSKPDQLLLLLDGFEELTSTLIDRLE
DLSEDWRQKLPGSVLLSSLLSKTMLPEATLLIMIRFTSWQTCKPLLKCPSLVTLPGFNTM
EKIKYFQMYFGHTEEGDQVLSFAMENTILFSMCRVPVVCWMVCSGLKQQMERGNNLTQSC
PNATSVFVRYISSLFPTRAENFSRKIHQAQLEGLCHLAADSMWHRKWVLGKEDLEEAKLD
QTGVTAFLGMSILRRIAGEEDHYVFTLVTFQEFFAALFYVLCFPQRLKNFHVLSHVNIQR
LIASPRGSKSYLSHMGLFLFGFLNEACASAVEQSFQCKVSFGNKRKLLKVIPLLHKCDPP
SPGSGVPQLFYCLHEIREEAFVSQALNDYHKVVLRIGNNKEVQVSAFCLKRCQYLHEVEL
TVTLNFMNVWKLSSSSHPGSEAPESNGLHRWWQDLCSVFATNDKLEVLTMTNSVLGPPFL
KALAAALRHPQCKLQKLLLRRVNSTMLNQDLIGVLTGNQHLRYLEIQHVEVESKAVKLLC
RVLRSPRCRLQCLRLEDCLATPRIWTDLGNNLQGNGHLKTLILRKNSLENCGAYYLSVAQ
LERLSIENCNLTQLTCESLASCLRQSKMLTHLSLAENALKDEGAKHIWNALPHLRCPLQR
LVLRKCDLTFNCCQDMISALCKNKTLKSLDLSFNSLKDDGVILLCEALKNPDCTLQILEL
ENCLFTSICCQAMASMLRKNQHLRHLDLSKNAIGVYGILTLCEAFSSQKKREEVIFCIPA
WTRITSFSPTPHPPDFTGKSDCLSQINP
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgtgaatccaccctctgacacccccattcccttttcatcctcctccactcac
agttctcatattccgccctggacattctcttgctaccccggctccccatgtgaaaatggg
gtcatgctgtacatgagaaacgtgagccatgaggagctacaacggttcaagcagctctta
ctgactgagctcagtactggcaccatgcccatcacctgggaccaggtcgagacagccagc
tgggcagaggtggttcatctcttgatagagcgtttccctggacgacgcgcttgggatgtg
acttcgaacatctttgccattatgaactgtgataaaatgtgtgttgtagtccgcagagag
ataaatgccattctgcctaccttggaaccagaggacttgaatgtgggagaaacacaggtg
aatctggaggaaggagaatctggtaaaatacggcggtataaatcgaatgtgatggaaaag
tttttccccatatgggacattacgacttggcctggaaaccagagggacttcttctaccaa
ggtgtacacaggcacgaggagtacttaccatgtctgcttctgcccaaaagaccccagggt
agacagcccaagaccgtggccatacagggagctcctgggatcggaaaaacaatcctggcc
aaaaaggtgatgtttgagtgggccagaaacaagttctacgcccacaagcgctggtgtgct
ttctacttccattgccaagaggtgaaccagacgacagaccagagcttctccgagctgatt
gagcaaaagtggcctggatctcaggacctcgtgtcaaagattatgtccaaacccgaccaa
cttctgctgctcttggatggctttgaggagctcacatctaccctcattgacagactggag
gacctgagtgaagactggaggcagaaattgcctgggtctgtcctactgagcagtttgctg
agcaaaacgatgcttccagaggccacgctactgatcatgataagatttacctcttggcag
acatgcaagcccttgctgaaatgtccctctctcgtaacccttccggggtttaatacgatg
gaaaaaatcaagtatttccagatgtattttggacacacagaggagggagaccaagtcttg
agtttcgccatggaaaacaccattctcttctccatgtgccgggtccctgtggtttgctgg
atggtctgctctggtctgaaacagcaaatggagagaggaaacaatctcacacagtcatgt
ccaaatgccacctctgtgttcgtccggtatatttctagcttgtttcccaccagagctgag
aacttttccagaaagatccaccaagcacaactggaaggtctgtgtcacttggccgcagac
agcatgtggcacaggaaatgggtgttaggtaaagaagatcttgaggaagccaagctggat
cagacgggagtcaccgccttccttggcatgagtattcttcggagaattgcaggtgaggaa
gaccactatgtctttaccctcgtgacttttcaggaattttttgcggccttgttttatgtt
ctctgtttcccacaaagactcaaaaattttcatgtgttgagccacgtgaatatccagcgc
ctgatagcgagtcccagaggaagcaaaagctatctctctcacatgggacttttcttattc
ggttttctgaacgaggcctgcgcttcggccgtggaacagtcattccaatgcaaggtgtct
ttcggtaataagaggaaactgctgaaagtcatacctctgttgcataaatgtgacccacct
tctccgggcagtggggtcccgcagttattctactgtctgcatgaaatccgggaggaagcc
tttgtaagccaagccctaaatgattatcataaagttgtcttgagaattggcaacaacaaa
gaagttcaagtgtctgctttttgcctgaagcggtgtcaatatttgcatgaggtggaactg
accgtcaccctgaacttcatgaacgtgtggaagctcagctccagctcccatcctggctct
gaagcgccagagagcaatgggctgcatcgttggtggcaagacttatgctctgtgtttgca
acgaatgataagctggaagtcctgactatgaccaacagtgttttggggcctccttttttg
aaggctctcgcggccgcactgaggcaccctcagtgcaaactgcaaaagctactcctaagg
cgtgtgaatagcaccatgttgaaccaggacttaatcggtgttttgacggggaaccagcat
ctgagatacttggaaatacaacatgtggaagtggagtccaaagctgtgaagcttctatgc
agggtgctgagatccccccggtgccgtctgcagtgtctcaggttggaagactgcttggcc
acccctagaatttggactgatcttggcaataatcttcaaggtaacgggcatctaaagact
ctcatactaagaaaaaactccctggagaactgtggggcgtattacctgtctgtggcccag
ctggagaggctgtcgatagagaactgcaaccttacacagcttacttgtgaaagccttgcc
tcctgtctcaggcagagtaagatgctgacccacctgagcttggcagaaaacgccttgaaa
gatgaaggggccaagcatatttggaatgccctgccacacctgagatgtcctctgcagagg
ctggtactgagaaagtgtgacttgacctttaattgctgtcaggatatgatctctgcgctc
tgtaaaaataaaaccctgaaaagtcttgacctaagttttaatagcctgaaggatgatggg
gtgatcctgctgtgtgaggccctgaagaaccctgactgtacattacagatcctggagctg
gaaaactgcctgttcacctccatctgctgccaggccatggcttccatgctccgcaaaaac
caacatctgagacatctggacttgagcaagaatgcgattggagtctatggtattctgacc
ttgtgcgaggccttctcaagccaaaagaagagagaagaggtcattttctgtattcctgcc
tggactcgaataactagcttctccccaactcctcacccacccgacttcacgggaaaaagt
gactgcctatcccagattaatccttag

DBGET integrated database retrieval system