KEGG   Homo sapiens (human): 126382
Entry
126382            CDS       T01001                                 
Symbol
NR2C2AP, TRA16
Name
(RefSeq) nuclear receptor 2C2 associated protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: F5_F8_type_C F5_F8_type_C_2 Sad1_UNC ANAPC10 MHC_II_beta
Other DBs
NCBI-GeneID: 126382
NCBI-ProteinID: NP_795361
OMIM: 608719
HGNC: 30763
Ensembl: ENSG00000184162
UniProt: Q86WQ0
Position
19:complement(19201409..19203414)
AA seq 139 aa
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVS
QLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDA
TDFFGRVVIYHLRVLGEKV
NT seq 420 nt   +upstreamnt  +downstreamnt
atgacccactctttggtttgtccagagacagtgagcagggtgagttcagtgctgaatcgc
aacactcggcagtttggaaaaaaacatcttttcgaccaggatgaggagacatgttggaac
tcagaccagggcccctcccagtgggtgacgctggagtttccccagctcatccgtgtctcc
cagctgcagatccagtttcagggtggcttctccagtcgccggggctgcctggaaggttca
cagggcactcaggctctccacaagattgtagatttctaccctgaggacaacaactcgctt
cagactttccccataccagctgctgaagtggaccggctgaaggtgacgtttgaggatgcc
actgacttttttggccgtgtggtcatctaccacctgcgggtgcttggggagaaggtgtga

DBGET integrated database retrieval system