KEGG   Homo sapiens (human): 1264Help
Entry
1264              CDS       T01001                                 

Gene name
CNN1, HEL-S-14, SMCC, Sm-Calp
Definition
(RefSeq) calponin 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Calponin CH CAMSAP_CH Raf1_HTH CDC24
Motif
Other DBs
NCBI-GeneID: 1264
NCBI-ProteinID: NP_001290
OMIM: 600806
HGNC: 2155
Ensembl: ENSG00000130176
Vega: OTTHUMG00000182033
Pharos: P51911(Tbio)
UniProt: P51911 V9HWA5
Structure
PDB: 

Position
19p13.2
AA seq 297 aa AA seqDB search
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgctcacttcaaccgaggccctgcctacgggctgtcagccgaggttaagaac
aagctggcccagaagtatgaccaccagcgggagcaggagctgagagagtggatcgagggg
gtgacaggccgtcgcatcggcaacaacttcatggacggcctcaaagatggcatcattctt
tgcgaattcatcaataagctgcagccaggctccgtgaagaagatcaatgagtcaacccaa
aattggcaccagctggagaacatcggcaacttcatcaaggccatcaccaagtatggggtg
aagccccacgacatttttgaggccaacgacctgtttgagaacaccaaccatacacaggtg
cagtccaccctcctggctttggccagcatggcgaagacgaaaggaaacaaggtgaacgtg
ggagtgaagtacgcagagaagcaggagcggaaattcgagccggggaagctaagagaaggg
cggaacatcattgggctgcagatgggcaccaacaagtttgccagccagcagggcatgacg
gcctatggcacccggcgccacctctacgaccccaagctgggcacagaccagcctctggac
caggcgaccatcagcctgcagatgggcaccaacaaaggagccagccaggctggcatgact
gcgccagggaccaagcggcagatcttcgagccggggctgggcatggagcactgcgacacg
ctcaatgtcagcctgcagatgggcagcaacaagggcgcctcgcagcggggcatgacggtg
tatgggctgccacgccaggtctacgaccccaagtactgtctgactcccgagtacccagag
ctgggtgagcccgcccacaaccaccacgcacacaactactacaattccgcctag

DBGET integrated database retrieval system