KEGG   Homo sapiens (human): 126433Help
Entry
126433            CDS       T01001                                 

Gene name
FBXO27, FBG5, Fbx27
Definition
(RefSeq) F-box protein 27
  KO
K10102  F-box protein 27
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    126433 (FBXO27)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    126433 (FBXO27)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     126433 (FBXO27)
Lectins [BR:hsa04091]
 F-box lectins
  126433 (FBXO27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBA F-box F-box-like
Motif
Other DBs
NCBI-GeneID: 126433
NCBI-ProteinID: NP_849142
OMIM: 609099
HGNC: 18753
Ensembl: ENSG00000161243
Vega: OTTHUMG00000182719
Pharos: Q8NI29(Tbio)
UniProt: Q8NI29 A0A384MR61
Position
19q13.2
AA seq 283 aa AA seqDB search
MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRAL
VDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCG
QEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLD
SGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHV
FSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctcggtctccaggggccgggccgcccgggtccccgcgccggagccggaaccc
gaagaggcgctggacctgagccaactacccccagagctgcttctggtggtgctgagccac
gtccccccgcgcacgctgctcgggcgctgccgccaagtgtgccggggctggcgagccctg
gtggacggccaggccctgtggctgctgatcctggcccgcgaccacggcgccaccggccgc
gcgctgctgcacctcgcccgcagctgccagtctcccgcccgtaacgccaggccttgcccc
ctgggccgcttctgcgcgcgcagacccatcggacgcaaccttattcgcaacccctgcggc
caagaaggcctccgaaagtggatggtgcaacacggtggggacggctgggtggtggaggaa
aacaggacaaccgtgcctggggccccttctcagacgtgcttcgtgacttcattcagctgg
tgttgcaagaagcaggtcttggacctagaggaggagggtctgtggccagaactgctggat
agtggcaggattgagatttgtgtctctgactggtggggagcccgacacgacagcggctgt
atgtacagactcctcgtccaacttctagacgccaaccagactgttctagataaattctct
gctgtgcctgatcccatcccgcagtggaacaacaatgcctgccttcacgtcacccacgtg
ttctccaacatcaagatgggcgtccgctttgtgtctttcgaacaccggggccaggacaca
cagttctgggctggccactatggagcccgtgtgaccaactccagtgtgatcgtgcgagtc
cgtctgtcctag

DBGET integrated database retrieval system