KEGG   Homo sapiens (human): 1265
Entry
1265              CDS       T01001                                 
Symbol
CNN2
Name
(RefSeq) calponin 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Calponin CH CAMSAP_CH
Other DBs
NCBI-GeneID: 1265
NCBI-ProteinID: NP_004359
OMIM: 602373
HGNC: 2156
Ensembl: ENSG00000064666
Pharos: Q99439(Tbio)
UniProt: Q99439
Structure
Position
19:1026608..1039065
AA seq 309 aa
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSG
MTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKC
DNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYP
PYYQEEAGY
NT seq 930 nt   +upstreamnt  +downstreamnt
atgagctccacgcagttcaacaagggcccctcgtacgggctgtcggccgaggtcaagaac
cggctcctgtccaaatatgacccccagaaggaggcagagctccgcacctggatcgaggga
ctcaccggcctctccatcggccccgacttccagaagggcctgaaggatggaactatctta
tgcacactcatgaacaagctacagccgggctccgtccccaagatcaaccgctccatgcag
aactggcaccagctagaaaacctgtccaacttcatcaaggccatggtcagctacggcatg
aaccctgtggacctgttcgaggccaacgacctgtttgagagtgggaacatgacgcaggtg
caggtgtctcttctcgccctggcggggaaggccaagactaaggggctgcagagcggggtg
gacattggcgtcaagtactcggagaagcaggagcggaatttcgacgatgccaccatgaag
gctggccagtgcgtcatcgggctgcagatgggcaccaacaaatgcgccagccagtcgggc
atgactgcctacggcacgagaaggcatctctatgaccccaagaaccatatcctgcccccc
atggaccactcgaccatcagcctccagatgggcacgaacaagtgtgccagccaggtgggc
atgacggctcccgggacccggcggcacatctatgataccaagctgggaaccgacaagtgt
gacaactcctccatgtccctgcagatgggctacacgcagggcgccaaccagagcggccag
gtcttcggcctgggccggcagatatatgaccccaagtactgcccgcaaggcacagtggcc
gatggggctccctcgggcaccggcgactgcccggacccgggggaggtccctgaatatccc
ccttactaccaggaggaggccggctactga

DBGET integrated database retrieval system