KEGG   Homo sapiens (human): 126526
Entry
126526            CDS       T01001                                 
Symbol
C19orf47
Name
(RefSeq) chromosome 19 open reading frame 47
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5577 SAM_4 SAM_2 SAM_1 Met_asp_mut_E
Other DBs
NCBI-GeneID: 126526
NCBI-ProteinID: NP_001243369
HGNC: 26723
Ensembl: ENSG00000160392
Pharos: Q8N9M1(Tdark)
UniProt: Q8N9M1
Position
19:complement(40292954..40348527)
AA seq 422 aa
MVMAALSLVAACWGRAAADESVQLPAAPGSSVRARETMVSVTMATSEWIQFFKEAGIPPG
PAVNYAVMFVDNRIQKSMLLDLNKEIMNELGVTVVGDIIAILKHAKVVHRQDMCKAATES
VPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVTVSNKMAAKSA
KATAALARREEESLAVPAKRRRVTAEMEGKYVINMPKGTTPRTRKILEQQQAAKGLHRTS
VFDRLGAETKADTTTGSKPTGVFSRLGATPETDEDLAWDSDNDSSSSVLQYAGVLKKLGR
GPAKASPQPALTVKAKATSSATTAAAPTLRRLALSSRSGLERKPESLSKVSIIKRLGAAA
LVPEAQDSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKRLGRR
TF
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggttatggccgcactctcgctggtggcggcctgttggggtagagcggccgcggacgag
tcagttcagcttccggcggctccagggagcagtgtcagggccagggagacgatggtctcc
gtgactatggccacttccgagtggatccagttctttaaggaagccggcattcctccagga
cctgccgtcaattatgccgtgatgtttgtggataataggattcagaagagcatgctgctg
gatctcaataaggagataatgaatgagctgggcgtgaccgtggtgggtgacatcatcgcc
attctcaagcatgccaaagtggtgcaccgtcaggacatgtgcaaagctgccactgagtca
gtaccctgcagccctagcccccttgcaggcgaaattcgccgtggcaccagtgctgcctcc
cgaatgatcaccaacagcctgaaccatgactctccacccagcacaccccccaggcgcccg
gacaccagcacctccaagatctcggtcactgtgtccaacaagatggcagcaaagagtgcc
aaggccactgcagccctggcccgccgggaggaggagagcctggctgttcctgccaagcgg
cgccgggtcactgctgagatggaggggaagtacgtcatcaacatgcccaaaggcaccaca
ccccgcacccgcaagatcctggagcagcagcaggctgcaaaaggtctccataggacgtct
gtgtttgaccgcctcggcgccgagaccaaggcagacaccacgacagggagtaaacccaca
ggagtcttcagccgcctgggggccaccccagaaacggacgaggatctggcttgggacagc
gacaatgacagcagcagctctgtcttgcagtatgccggggtcctgaagaagctaggacgg
ggcccagccaaggccagtccccagccagcactgactgtcaaagccaaggccacaagctca
gcgacaacggctgctgccccgacactgcggcgcctggcgctttcctcacggtctgggctt
gagaggaagccggagtccttgtctaaagtcagcatcatcaagagactgggcgcagctgcc
cttgtgcccgaggcccaggacagccaggtcaccagcaccaagagtaagtcctcagccgag
gtcaaggtcaccattaagaggactctggtggggccccgggggagcagctccagcgagggc
cttggtgcccagatggaccacgcgggcactgtgagcgtgttcaaaagactgggccgcagg
accttctag

DBGET integrated database retrieval system