KEGG   Homo sapiens (human): 126549
Entry
126549            CDS       T01001                                 

Gene name
ANKLE1, ANKRD41, LEM3, LEMD6
Definition
(RefSeq) ankyrin repeat and LEM domain containing 1
  KO
K21411  ankyrin repeat and LEM domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    126549 (ANKLE1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Nucleases
    126549 (ANKLE1)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 LEM
Other DBs
NCBI-GeneID: 126549
NCBI-ProteinID: NP_689576
HGNC: 26812
Ensembl: ENSG00000160117
Vega: OTTHUMG00000150839
Pharos: Q8NAG6(Tbio)
UniProt: Q8NAG6 B4E124 A0A499FJM0
Position
19p13.11
AA seq 615 aa
MCSEARLARRLRDALREEEPWAVEELLRCGADPNLVLEDGAAAVHLAAGARHPRGLRCLG
ALLRQGGDPNARSVEALTPLHVAAAWGCRRGLELLLSQGADPALRDQDGLRPLDLALQQG
HLECARVLQDLDTRTRTRTRIGAETQEPEPAPGTPGLSGPTDETLDSIALQKQPCRGDNR
DIGLEADPGPPSLPVPLETVDKHGSSASPPGHWDYSSDASFVTAVEVSGAEDPASDTPPW
AGSLPPTRQGLLHVVHANQRVPRSQGTEAELNARLQALTLTPPNAAGFQSSPSSMPLLDR
SPAHSPPRTPTPGASDCHCLWEHQTSIDSDMATLWLTEDEASSTGGREPVGPCRHLPVST
VSDLELLKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIP
DVQADEDALAQQFEQPDPARRWREGVVKSSFTYLLLDPRETQDLPARAFSLTPAERLQTF
IRAIFYVGKGTRARPYVHLWEALGHHGRSRKQPHQACPKVRQILDIWASGCGVVSLHCFQ
HVVAVEAYTREACIVEALGIQTLTNQKQGHCYGVVAGWPPARRRRLGVHLLHRALLVFLA
EGERQLHPQDIQARG
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgtgctcggaggcccgcctggctcgcaggttgcgggatgcgctgcgggaggaggagccg
tgggcagtagaggagctgctgcgctgcggcgcggaccctaatttggtgctagaggacggc
gcagcggctgtgcacttggcggccggagcccggcacccgcgcggcctgcgttgcctcggg
gccctactgcgccaaggcggggaccccaacgctcgatctgtcgaggcactgacgccgctg
catgtggccgccgcgtggggctgccgccgcggcctggagctgctgctgagccaaggagcg
gacccggcgctgcgcgaccaggacggactccggccgctggacctggccctgcagcaggga
cacctggagtgcgcgcgagtcctgcaggatctcgacacgcggaccaggacccggacccgg
atcggggcagagactcaggagcccgagcctgcacctggcaccccaggcctctctggacct
accgatgagacgctggactccatagcactccaaaagcagccatgcagaggtgacaacagg
gacattggcttggaggctgacccaggaccccccagcctccctgttccccttgaaactgtg
gacaaacatgggagctcggcgtcccctccagggcactgggattacagctcagacgcctct
ttcgtcacagcggttgaggtctctggagctgaggacccagcctcggacactcccccctgg
gctgggtcattgccaccgaccaggcagggacttctgcatgttgtccatgccaaccagagg
gtacctaggtctcagggcacggaggcagaactgaatgcccgtctgcaggccctgactctg
accccaccaaatgctgctggcttccagtcctccccttcctccatgcctctcctggacagg
agtccagctcatagccccccacggacaccaacccctggagcttctgactgccactgcctg
tgggagcaccagacatccattgatagtgacatggccacgctctggctgacagaggatgag
gcaagctctacaggtggcagggaacctgtcggcccttgccggcacctgccagtctccact
gtgtctgacttggagttgctgaagggactccgagcacttggtgagaatcctcaccccatc
acacccttcaccaggcagttgtaccaccagcagctggaagaagcccagattgctcctggc
ccagagttttcagggcacagcctagaactggctgcagccctgcggacgggctgtattcca
gatgtccaggcagatgaagacgcgctggcccagcagtttgagcagccagatcctgccagg
aggtggcgggagggggtcgtgaagtctagcttcacctatctgctgctggaccccagggag
actcaggacctgccagcccgagccttctcactgaccccagctgagcgccttcagactttc
atccgtgccatcttctacgtgggcaaagggacgagggcccggccatatgtccacctctgg
gaggcccttggtcaccatgggcggtcaagaaaacagccccaccaggcctgccccaaggtg
cgtcagatcttggacatctgggccagtggttgcggtgttgtgtccctacattgcttccag
cacgtggtcgctgtggaggcttatacacgggaggcgtgtattgtggaagccctagggatc
cagacgctcaccaaccagaagcaagggcactgctatggagtggtggcaggctggccacct
gctcgtcgccggcgcttgggggtgcacctgctgcaccgtgccctccttgtcttcctggct
gaaggcgagcgacagcttcatccccaggacatccaggcccggggctga

DBGET integrated database retrieval system