KEGG   Homo sapiens (human): 126638
Entry
126638            CDS       T01001                                 

Gene name
RPTN
Definition
(RefSeq) repetin
  KO
K23927   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_6 EF-hand_4
Other DBs
NCBI-GeneID: 126638
NCBI-ProteinID: NP_001116437
OMIM: 613259
HGNC: 26809
Ensembl: ENSG00000215853
Vega: OTTHUMG00000154095
Pharos: Q6XPR3(Tdark)
UniProt: Q6XPR3
Position
1q21.3
AA seq 784 aa
MAQLLNSILSVIDVFHKYAKGNGDCALLCKEELKQLLLAEFGDILQRPNDPETVETILNL
LDQDRDGHIDFHEYLLLVFQLVQACYHKLDNKSHGGRTSQQERGQEGAQDCKFPGNTGRQ
HRQRHEEERQNSHHSQPERQDGDSHHGQPERQDRDSHHGQSEKQDRDSHHSQPERQDRDS
HHNQSERQDKDFSFDQSERQSQDSSSGKKVSHKSTSGQAKWQGHIFALNRCEKPIQDSHY
GQSERHTQQSETLGQASHFNQTNQQKSGSYCGQSERLGQELGCGQTDRQGQSSHYGQTDR
QDQSYHYGQTDRQGQSSHYSQTDRQGQSSHYSQPDRQGQSSHYGQMDRKGQCYHYDQTNR
QGQGSHYSQPNRQGQSSHYGQPDTQDQSSHYGQTDRQDQSSHYGQTERQGQSSHYSQMDR
QGQGSHYGQTDRQGQSSHYGQPDRQGQNSHYGQTDRQGQSSHYGQTDRQGQSSHYSQPDK
QGQSSHYGKIDRQDQSYHYGQPDGQGQSSHYGQTDRQGQSFHYGQPDRQGQSSHYSQMDR
QGQSSHYGQTDRQGQSSHYGQTDRQGQSYHYGQTDRQGQSSHYIQSQTGEIQGQNKYFQG
TEGTRKASYVEQSGRSGRLSQQTPGQEGYQNQGQGFQSRDSQQNGHQVWEPEEDSQHHQH
KLLAQIQQERPLCHKGRDWQSCSSEQGHRQAQTRQSHGEGLSHWAEEEQGHQTWDRHSHE
SQEGPCGTQDRRTHKDEQNHQRRDRQTHEHEQSHQRRDRQTHEDKQNRQRRDRQTHEDEQ
NHQR
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggctcaactcctgaatagcatactcagtgtgattgacgtattccacaaatatgccaaa
gggaatggggactgtgccttactatgcaaggaagagttgaaacaactgctcttggctgag
tttggagacatcctccagagaccaaatgacccagagactgtggaaaccatcttgaacctc
ttagatcaagaccgagatggacatattgattttcatgagtacctcttgttggtgttccag
ttggtccaagcctgctatcataagctagacaataagtcacatggaggcaggacctcacag
caagaaagggggcaggaaggagcacaagactgtaagttcccaggaaacacaggcagacaa
cacagacagaggcacgaggaagaaaggcagaactcccaccacagtcagcctgagagacaa
gacggagattcccaccatggtcagcctgagagacaagacagagattcccaccatggtcag
tctgagaaacaagacagagattcccaccacagtcagcctgagagacaagacagagattct
caccacaatcagtctgagagacaagacaaggatttcagctttgatcagtcagagagacaa
agtcaagactccagctctggtaaaaaagtgagtcacaaatctaccagtggccaggctaaa
tggcagggacatatctttgccttaaatcggtgtgaaaaaccaattcaggattctcattat
ggtcagtctgaaagacatacacaacaatctgaaacacttggacaagcctctcactttaac
cagacaaatcaacagaaatcaggctcttattgtggacagtctgagaggctaggtcaggaa
ttaggctgtggtcagacagacagacaaggccagagttcccactacggtcagacggacaga
caagaccagagttatcattatggtcagacagacagacaaggccagagttcccactacagt
cagacggacagacaaggccagagttcccactacagtcagccagacagacaaggtcagagt
tcccactatggtcaaatggacagaaaaggccagtgttatcattatgatcagacaaacaga
caaggccagggttcccactacagtcaaccaaacagacaaggtcagagttcccactatggt
cagccagacacacaagatcagagttctcactatggtcagacagacagacaagaccaaagt
tctcactatggtcagacagagagacaaggccagagttcccactacagtcagatggaccga
caaggccagggttctcactacggtcagacagacagacaaggccagagttcccactatggt
cagccagacagacaaggccagaattcccactatggtcagacagacagacaaggccagagt
tcccactatggtcagacagacagacaaggccagagttcccactacagtcagccagacaaa
caaggccagagttcccactatggtaagatagacagacaagaccagagttatcattatggt
cagccagacggacaaggccaaagttcccactatggtcagacagacagacaaggccagagt
ttccactatggtcagccagacagacaaggccagagttcccactacagtcagatggacaga
caaggccagagttcccactatggtcagacagacagacaaggccagagttcccactacggt
cagacagacagacaaggccagagctatcattatggtcagacagacagacaaggccagagt
tcccactatattcaatcacagactggggaaatacaagggcaaaataagtacttccaaggg
actgaaggaacaagaaaagcctcttatgttgaacaatcaggaagatcagggaggctaagt
caacagactccaggacaggaagggtaccaaaaccagggacagggattccagtctagggac
tcacagcagaacggccaccaggtatgggagcctgaagaggatagccaacatcaccaacac
aaactcttagcacaaatccaacaagaaagaccactttgtcacaaagggagagactggcaa
tcatgcagtagtgagcagggccacagacaggcccagaccaggcagagtcatggtgagggg
ctgagccactgggcagaggaagagcagggccatcaaacttgggatagacacagccatgag
agtcaggaaggtccatgtgggacacaggacaggcgaacccataaagatgagcagaaccat
cagagacgagacagacaaacccatgaacatgagcagagccatcagagacgagacaggcaa
acccatgaagacaagcagaaccgtcagagacgagacaggcaaacccatgaagacgagcag
aaccatcagagatga

DBGET integrated database retrieval system