KEGG   Homo sapiens (human): 1267Help
Entry
1267              CDS       T01001                                 

Gene name
CNP, CNP1
Definition
(RefSeq) 2',3'-cyclic nucleotide 3' phosphodiesterase
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1267 (CNP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     1267 (CNP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   1267 (CNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase AAA_33 6PF2K AAA_22 KTI12 Zeta_toxin AAA AAA_16 ABC_tran AAA_17 AAA_30 NACHT AAA_18 RsgA_GTPase NB-ARC DUF4823 AAA_14
Motif
Other DBs
NCBI-GeneID: 1267
NCBI-ProteinID: NP_149124
OMIM: 123830
HGNC: 2158
Ensembl: ENSG00000173786
Vega: OTTHUMG00000133502
Pharos: P09543(Tbio)
UniProt: P09543
Structure
PDB: 

Position
17q21.2
AA seq 421 aa AA seqDB search
MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPG
SGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILV
LDDTNHERERLEQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPG
LEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVT
YFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARV
ELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSR
GEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaggcttctcccgaaaaagccacacattcctgcccaagatcttcttccgcaag
atgtcatcctcaggggccaaggacaagcctgagctgcagtttcccttccttcaggatgag
gacacagtggccacgctgctagagtgcaagacgctcttcatcttgcgcggcctgccagga
agcggcaagtccacgctggcacgggtcatcgtggacaagtaccgtgatggcaccaagatg
gtgtcggctgacgcttacaagatcacccccggcgctcgaggagccttctccgaggagtac
aagcggctcgatgaggacctggctgcctactgccgccgccgggacatcagaattcttgtg
cttgatgacaccaaccacgaacgggaacggctggagcagctctttgaaatggccgaccag
taccagtaccaggtggtgctggtggagcccaagacggcgtggcggctggactgtgcccag
ctcaaggagaagaaccagtggcagctgtcggctgatgacctgaagaagctgaagcctggg
ctggagaaggacttcctgccgctctacttcggctggttcctgaccaagaagagctctgag
accctccgcaaagccggccaggtcttcctggaagagctggggaaccacaaggccttcaag
aaggagctgcgacaattcgtccctggggatgagcccagggagaagatggacttggtcacc
tactttggaaagagacccccaggcgtgctgcattgcacaaccaagttttgtgactacggg
aaggctcccggggcagaggagtacgctcaacaagatgtgttaaagaaatcttactccaag
gccttcacgctgaccatctctgccctctttgtgacacccaagacgactggggcccgggtg
gagttaagcgagcagcaactgcagttgtggccgagtgatgtggacaagctgtcacccact
gacaacctgccgcgggggagccgcgcccacatcaccctcggctgtgcagctgacgtagag
gccgtgcagacgggccttgacctcttagagattctgcggcaggagaaggggggcagccga
ggcgaggaggtgggcgagctaagccggggcaagctctattccttgggcaatgggcgctgg
atgctgaccctggccaagaacatggaggtcagggccatcttcacggggtactacgggaaa
ggcaaacctgtgcccacgcaaggtagccggaaggggggcgccttgcagtcctgcaccatc
atatga

DBGET integrated database retrieval system