KEGG   Homo sapiens (human): 1268Help
Entry
1268              CDS       T01001                                 

Gene name
CNR1, CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR
Definition
(RefSeq) cannabinoid receptor 1
  KO
K04277  cannabinoid receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
Drug target
Cannabidiol: D10915
Dronabinol: D00306
Ibipinabant: D09349
Levonantradol hydrochloride: D04717
Nabilone: D05099
Nantradol hydrochloride: D05117
Otenabant (DG01351): D09362 D09363
Rimonabant: D05731
Taranabant: D09009
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    1268 (CNR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1268 (CNR1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    1268 (CNR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1268 (CNR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1268 (CNR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Cannabinoid
    1268 (CNR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx YlaC
Motif
Other DBs
NCBI-GeneID: 1268
NCBI-ProteinID: NP_001153698
OMIM: 114610
HGNC: 2159
Ensembl: ENSG00000118432
Vega: OTTHUMG00000015184
Pharos: P21554(Tclin)
UniProt: P21554 S5TLS4
Structure
PDB: 

Position
6q15
AA seq 472 aa AA seqDB search
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgatcctagatggccttgcagataccaccttccgcaccatcaccactgacctc
ctgtacgtgggctcaaatgacattcagtacgaagacatcaaaggtgacatggcatccaaa
ttagggtacttcccacagaaattccctttaacttcctttaggggaagtcccttccaagag
aagatgactgcgggagacaacccccagctagtcccagcagaccaggtgaacattacagaa
ttttacaacaagtctctctcgtccttcaaggagaatgaggagaacatccagtgtggggag
aacttcatggacatagagtgtttcatggtcctgaaccccagccagcagctggccattgca
gtcctgtccctcacgctgggcaccttcacggtcctggagaacctcctggtgctgtgcgtc
atcctccactcccgcagcctccgctgcaggccttcctaccacttcatcggcagcctggcg
gtggcagacctcctggggagtgtcatttttgtctacagcttcattgacttccacgtgttc
caccgcaaagatagccgcaacgtgtttctgttcaaactgggtggggtcacggcctccttc
actgcctccgtgggcagcctgttcctcacagccatcgacaggtacatatccattcacagg
cccctggcctataagaggattgtcaccaggcccaaggccgtggtggcgttttgcctgatg
tggaccatagccattgtgatcgccgtgctgcctctcctgggctggaactgcgagaaactg
caatctgtttgctcagacattttcccacacattgatgaaacctacctgatgttctggatc
ggggtcaccagcgtactgcttctgttcatcgtgtatgcgtacatgtatattctctggaag
gctcacagccacgccgtccgcatgattcagcgtggcacccagaagagcatcatcatccac
acgtctgaggatgggaaggtacaggtgacccggccagaccaagcccgcatggacattagg
ttagccaagaccctggtcctgatcctggtggtgttgatcatctgctggggccctctgctt
gcaatcatggtgtatgatgtctttgggaagatgaacaagctcattaagacggtgtttgca
ttctgcagtatgctctgcctgctgaactccaccgtgaaccccatcatctatgctctgagg
agtaaggacctgcgacacgctttccggagcatgtttccctcttgtgaaggcactgcgcag
cctctggataacagcatgggggactcggactgcctgcacaaacacgcaaacaatgcagcc
agtgttcacagggccgcagaaagctgcatcaagagcacggtcaagattgccaaggtaacc
atgtctgtgtccacagacacgtctgccgaggctctgtga

DBGET integrated database retrieval system