KEGG   Homo sapiens (human): 1269Help
Entry
1269              CDS       T01001                                 

Gene name
CNR2, CB-2, CB2, CX5
Definition
(RefSeq) cannabinoid receptor 2
  KO
K04278  cannabinoid receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Cannabidiol: D10915
Dronabinol: D00306
Lenabasum: D11312
Nabilone: D05099
Olorinab: D11429
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1269 (CNR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1269 (CNR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Cannabinoid
    1269 (CNR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 1269
NCBI-ProteinID: NP_001832
OMIM: 605051
HGNC: 2160
Ensembl: ENSG00000188822
Vega: OTTHUMG00000013892
Pharos: P34972(Tchem)
UniProt: P34972 A0A024RAH7
Position
1p36.11
AA seq 360 aa AA seqDB search
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatgctgggtgacagagatagccaatggctccaaggatggcttggattccaac
cctatgaaggattacatgatcctgagtggtccccagaagacagctgttgctgtgttgtgc
actcttctgggcctgctaagtgccctggagaacgtggctgtgctctatctgatcctgtcc
tcccaccaactccgccggaagccctcatacctgttcattggcagcttggctggggctgac
ttcctggccagtgtggtctttgcatgcagctttgtgaatttccatgttttccatggtgtg
gattccaaggctgtcttcctgctgaagattggcagcgtgactatgaccttcacagcctct
gtgggtagcctcctgctgaccgccattgaccgatacctctgcctgcgctatccaccttcc
tacaaagctctgctcacccgtggaagggcactggtgaccctgggcatcatgtgggtcctc
tcagcactagtctcctacctgcccctcatgggatggacttgctgtcccaggccctgctct
gagcttttcccactgatccccaatgactacctgctgagctggctcctgttcatcgccttc
ctcttttccggaatcatctacacctatgggcatgttctctggaaggcccatcagcatgtg
gccagcttgtctggccaccaggacaggcaggtgccaggaatggcccgaatgaggctggat
gtgaggttggccaagaccctagggctagtgttggctgtgctcctcatctgttggttccca
gtgctggccctcatggcccacagcctggccactacgctcagtgaccaggtcaagaaggcc
tttgctttctgctccatgctgtgcctcatcaactccatggtcaaccctgtcatctatgct
ctacggagtggagagatccgctcctctgcccatcactgcctggctcactggaagaagtgt
gtgaggggccttgggtcagaggcaaaagaagaagccccgagatcctcagtcaccgagaca
gaggctgatgggaaaatcactccgtggccagattccagagatctagacctctctgattgc
tga

DBGET integrated database retrieval system