KEGG   Homo sapiens (human): 126961Help
Entry
126961            CDS       T01001                                 

Gene name
HIST2H3C, H3, H3.2, H3/M, H3F2, H3FM, H3FN
Definition
(RefSeq) histone cluster 2 H3 family member c
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    126961 (HIST2H3C)
  Immune diseases
   05322 Systemic lupus erythematosus
    126961 (HIST2H3C)
  Substance dependence
   05034 Alcoholism
    126961 (HIST2H3C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    126961 (HIST2H3C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126961 (HIST2H3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 126961
NCBI-ProteinID: NP_066403
OMIM: 142780
HGNC: 20503
Ensembl: ENSG00000203811
Vega: OTTHUMG00000012190
UniProt: Q71DI3
Structure
PDB: 

Position
1q21.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaagcagactgctcgcaagtcgaccggcggcaaggccccgaggaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtagccctgcgggagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatt
atgcccaaggacatccagctggcccgccgcatccgtggagagcgggcttaa

DBGET integrated database retrieval system