KEGG   Homo sapiens (human): 127Help
Entry
127               CDS       T01001                                 

Gene name
ADH4, ADH-2, HEL-S-4
Definition
(RefSeq) alcohol dehydrogenase 4 (class II), pi polypeptide
  KO
K13980  alcohol dehydrogenase 4 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    127 (ADH4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    127 (ADH4)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    127 (ADH4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    127 (ADH4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    127 (ADH4)
   00982 Drug metabolism - cytochrome P450
    127 (ADH4)
 09160 Human Diseases
  09161 Cancers
   05204 Chemical carcinogenesis
    127 (ADH4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     127 (ADH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 UDPG_MGDP_dh_N Glu_dehyd_C Thioredoxin
Motif
Other DBs
NCBI-GeneID: 127
NCBI-ProteinID: NP_000661
OMIM: 103740
HGNC: 252
Ensembl: ENSG00000198099
Vega: OTTHUMG00000161227
Pharos: P08319(Tbio)
UniProt: P08319 V9HVX7
Structure
PDB: 

Position
4q23
AA seq 380 aa AA seqDB search
MGTKGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEG
LAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLK
SPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGC
GFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKA
LGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGV
AAGSKGLTIFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDK
ISEAFDLMNQGKSVRTILIF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccaagggcaaagttattaaatgcaaagcagccatcgcctgggaagcaggcaag
cccctttgcattgaagaggttgaagtagctccccccaaggctcatgaagttcgcattcag
atcattgctacctccctgtgccatactgatgccactgttatcgattctaaatttgagggc
ctagctttcccagtgatcgttggccatgaggctgcaggtattgtggaaagtattgggcca
ggagtgaccaacgtcaaaccaggtgacaaagtaattccactttatgcacctctatgtaga
aaatgcaagttttgtctgagtccactcacaaatttgtgtgggaaaatcagtaatctcaaa
agtcctgctagtgatcaacaactaatggaagacaaaaccagcaggtttacctgcaaagga
aaaccagtttaccatttctttggaaccagtacattctctcagtacactgtggtgtcagat
atcaatcttgccaaaatagatgatgatgcaaatttagagagagtttgtctgcttggatgt
gggttttcaactggctatggggctgcaatcaacaatgccaaggtcacccctggttcgact
tgtgctgtctttggcctaggaggtgtgggtctttctgctgtaatgggttgtaaagcagca
ggagcttccagaatcataggtattgacatcaacagtgagaagtttgtgaaggctaaagcc
ctgggagccactgactgcctcaatcctagagacttacataaaccgatccaggaagttatc
attgaattgaccaagggaggtgtggattttgcccttgactgtgcaggtggatctgaaacc
atgaaagcagccctggactgtacaaccgcaggctggggatcatgtactttcattggagta
gctgctggtagcaaaggattgactatttttccagaggagctaataatcggccgtactata
aatggaacattctttggtggttggaaaagtgtagattctatcccaaagctggtcactgac
tataagaataagaaattcaatctggatgcactggtgacccataccctgccttttgacaaa
atcagtgaggcatttgacctaatgaaccaaggaaaaagcgtccgaacaatcctcatcttt
tga

DBGET integrated database retrieval system