KEGG   Homo sapiens (human): 1270Help
Entry
1270              CDS       T01001                                 

Gene name
CNTF, HCNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1270 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1270 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1270 (CNTF)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1270 (CNTF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNTF
Motif
Other DBs
NCBI-GeneID: 1270
NCBI-ProteinID: NP_000605
OMIM: 118945
HGNC: 2169
Ensembl: ENSG00000242689
Vega: OTTHUMG00000137476
Pharos: P26441(Tbio)
UniProt: P26441
Structure
PDB: 

Position
11q12.1
AA seq 200 aa AA seqDB search
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA
YQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFIS
SHQTGIPARGSHYIANNKKM
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcacagagcattcaccgctgacccctcaccgtcgggacctctgtagccgctct
atctggctagcaaggaagattcgttcagacctgactgctcttacggaatcctatgtgaag
catcagggcctgaacaagaacatcaacctggactctgcggatgggatgccagtggcaagc
actgatcagtggagtgagctgaccgaggcagagcgactccaagagaaccttcaagcttat
cgtaccttccatgttttgttggccaggctcttagaagaccagcaggtgcattttacccca
accgaaggtgacttccatcaagctatacatacccttcttctccaagtcgctgcctttgca
taccagatagaggagttaatgatactcctggaatacaagatcccccgcaatgaggctgat
gggatgcctattaatgttggagatggtggtctctttgagaagaagctgtggggcctaaag
gtgctgcaggagctttcacagtggacagtaaggtccatccatgaccttcgtttcatttct
tctcatcagactgggatcccagcacgtgggagccattatattgctaacaacaagaaaatg
tag

DBGET integrated database retrieval system