KEGG   Homo sapiens (human): 127062
Entry
127062            CDS       T01001                                 

Gene name
OR2M3, OR1-54, OR2M3P, OR2M6, OST003
Definition
(RefSeq) olfactory receptor family 2 subfamily M member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    127062 (OR2M3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    127062 (OR2M3)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    127062 (OR2M3)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 127062
NCBI-ProteinID: NP_001004689
HGNC: 8269
Ensembl: ENSG00000228198
Vega: OTTHUMG00000040459
Pharos: Q8NG83(Tdark)
UniProt: Q8NG83 A0A126GV67
Position
1q44
AA seq 312 aa
MARENSTFNSDFILLGIFNHSPTHTFLFFLVLAIFSVAFMGNSVMVLLIYLDTQLHTPMY
LLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYTSLLGSECFLLAVMAY
DRYTAICHPLRYTNLMSPKICGLMTAFSWILGSTDGIIDVVATFSFSYCGSREIAHFFCD
FPSLLILSCSDTSIFEKILFICCIVMIVFPVAIIIASYARVILAVIHMGSGEGRRKAFTT
CSSHLLVVGMYYGAALFMYIRPTSDRSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA
FMKILGKGKSGE
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcaagggagaattcgaccttcaactccgacttcatcctcctgggaatcttcaatcac
agccccacccacaccttcctcttctttctggtcctggccatcttttcagtggccttcatg
ggaaactctgtcatggttctcctcatctacctggacacccagctccacacccccatgtac
ctcctcctcagccaactgtccctcatggacctcatgctcatctgcaccaccgtacccaag
atggccttcaactacctgtctggcagcaagtccatttctatggctggttgtgccacacaa
attttcttctatacatcactgcttggctctgagtgctttcttttggctgttatggcttat
gaccgctacactgccatttgccaccctctaagatacaccaatctcatgagccctaaaatt
tgtggacttatgactgccttttcctggatcctgggctctacggatggaattattgatgtt
gtagcaacattttccttctcctactgtgggtctcgggaaatagcccacttcttctgtgac
ttcccctccctactaatcctctcatgcagtgacacatcaatatttgaaaagattcttttc
atctgctgtatagtaatgattgttttccctgttgcaatcatcattgcttcctatgctcga
gttatcctggctgtcattcacatgggatctggagagggtcgtcgcaaagcttttactact
tgttcctctcacctcttggtggtgggaatgtactatggagcagctttgttcatgtacata
cggcccacatctgatcgctccccaacacaggacaagatggtgtctgtattctacaccatc
ctcactcccatgttgaatcccctcatctacagcctccgcaacaaggaggtgaccagagca
ttcatgaagatcttaggaaagggcaagtctggagagtga

DBGET integrated database retrieval system