KEGG   Homo sapiens (human): 127064
Entry
127064            CDS       T01001                                 
Symbol
OR2T12, OR1-57
Name
(RefSeq) olfactory receptor family 2 subfamily T member 12
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    127064 (OR2T12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    127064 (OR2T12)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    127064 (OR2T12)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 127064
NCBI-ProteinID: NP_001004692
HGNC: 19592
Ensembl: ENSG00000177201
Pharos: Q8NG77(Tdark)
UniProt: Q8NG77
Position
1:complement(248290139..248303424)
AA seq 320 aa
MEMRNTTPDFILLGLFNHTRAHQVLFMMLLATVLTSLFSNALMILLIHWDHRLHRPMYFL
LSQLSLMDMMLVSTTVPKMAADYLTGNKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDR
YAAVCHPLRYPTLMSWQLCLRMTMSSWLLGAADGLLQAVATLSFPYCGAHEIDHFFCEAP
VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLLMRSTEARKKAFATCS
SHVAVVGLFYGAGIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVRNSEVKEALK
RWLGTCVNLKHQQNEAHRSR
NT seq 963 nt   +upstreamnt  +downstreamnt
atggagatgagaaatactaccccagattttattctcctaggactctttaaccacaccaga
gcccaccaagtcctcttcatgatgcttctggccaccgttttgacctccctgtttagcaat
gccctcatgattctcctgattcactgggaccaccggctccacaggcccatgtacttcctc
ctgagccaactttccctcatggacatgatgctggtttccaccactgtgcccaaaatggcg
gctgactacttgaccggaaataaggccatctcccgcgctggctgtggtgtgcagatcttc
ttcctccccacactgggtggtggagagtgcttcctcttagcagccatggcctatgaccgc
tatgcggctgtctgccacccactccgatatcccactctcatgagctggcagctgtgcctg
aggatgaccatgtcgtcctggctcctgggtgcagctgacggcctcctgcaggctgttgct
accctgagcttcccatattgcggtgcacacgagatcgatcacttcttctgcgaggccccc
gtgttggtgcgtttggcttgtgctgacacttcagtcttcgaaaacgccatgtacatctgc
tgtgtgttaatgctcctggtccccttttccctcatcctgtcctcctatggtctcatcctc
gctgctgttctgctcatgcgctctacagaagcccgcaagaaggcctttgccacctgctct
tcacatgtggctgtggtgggactcttttatggagctggcatttttacctatatgagaccc
aaatcccacaggtccactaaccacgataaggttgtgtcagccttctatactatgttcacc
cctttactaaatcccctcatctacagtgtgaggaacagtgaggtcaaggaagccctgaaa
cggtggctggggacgtgtgtaaacctaaaacaccagcaaaatgaggcccacaggtcaaga
tga

DBGET integrated database retrieval system