KEGG   Homo sapiens (human): 127124Help
Entry
127124            CDS       T01001                                 

Gene name
ATP6V1G3, ATP6G3, Vma10
Definition
(RefSeq) ATPase H+ transporting V1 subunit G3
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04150  mTOR signaling pathway
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    127124 (ATP6V1G3)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    127124 (ATP6V1G3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    127124 (ATP6V1G3)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    127124 (ATP6V1G3)
  Nervous system
   04721 Synaptic vesicle cycle
    127124 (ATP6V1G3)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    127124 (ATP6V1G3)
  Infectious diseases
   05110 Vibrio cholerae infection
    127124 (ATP6V1G3)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    127124 (ATP6V1G3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-ATPase_G DUF3552 FdhE OmpH T3SS_basalb_I RRF
Motif
Other DBs
NCBI-GeneID: 127124
NCBI-ProteinID: NP_573569
HGNC: 18265
Ensembl: ENSG00000151418
Vega: OTTHUMG00000035661
Pharos: Q96LB4(Tbio)
UniProt: Q96LB4
Position
1q31.3
AA seq 118 aa AA seqDB search
MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQS
KIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgacaagccagtctcaggggatccaccagcttcttcaggcagaaaaacgggccaaggac
aagctagaggaagccaagaagagaaaaggaaagcgattgaagcaagccaaggaggaagca
atggtagaaattgaccagtacagaatgcagagagataaagagtttcgactaaaacaatct
aagataatgggctctcagaataatctctcagatgaaatagaagaacaaacactagggaag
atacaagaacttaatggacactacaataagtatatggaaagtgtgatgaaccagctcttg
agcatggtctgtgacatgaaaccagaaatccatgtgaactacagagccaccaactaa

DBGET integrated database retrieval system