KEGG   Homo sapiens (human): 127281
Entry
127281            CDS       T01001                                 

Symbol
PRXL2B, C1orf93, FAM213B
Name
(RefSeq) peroxiredoxin like 2B
  KO
K15717  prostamide/prostaglandin F2alpha synthase [EC:1.11.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    127281 (PRXL2B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.20  prostamide/prostaglandin F2alpha synthase
     127281 (PRXL2B)
SSDB
Motif
Pfam: AhpC-TSA_2 AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 127281
NCBI-ProteinID: NP_689584
HGNC: 28390
Ensembl: ENSG00000157870
Vega: OTTHUMG00000000847
Pharos: Q8TBF2(Tdark)
UniProt: Q8TBF2 A0A2P0CTB1
Position
1p36.32
AA seq 198 aa
MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGL
LDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGK
PVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVL
GISAEVCASDPPQCDREV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgagcacggtggaccttgctcgcgtgggcgcgtgcatcctgaagcatgcggtgaccggg
gaggccgtggagctgcggagcctgtggcgggagcacgcgtgcgtggtggccgggctgcgg
cgcttcgggtgcgtggtgtgccgctggatcgcccaggacctcagcagccttgctgggctc
ctggaccaacacggcgtgcgcctggtgggcgtagggcccgaggccctgggtctgcaggag
ttcctggacggcgactacttcgcgggagagctctacctggatgagagcaagcagctttac
aaggagctaggcttcaagcggtacaacagcctgagcatcctcccagcagctctggggaag
cccgtgcgtgatgtggctgccaaggccaaggctgttggcatccaggggaacttgtctggg
gacctgctgcagagcggagggctgctggtggtcagcaaaggtggtgataaagtgctcctg
catttcgtccagaagtccccaggcgactacgtccccaaggagcacatcctgcaggtcctg
ggcatctctgcggaggtctgtgccagcgacccgcctcagtgtgacagagaggtgtga

DBGET integrated database retrieval system