KEGG   Homo sapiens (human): 127385
Entry
127385            CDS       T01001                                 
Symbol
OR10J5, MOR23, OLFR16, OR1-28
Name
(RefSeq) olfactory receptor family 10 subfamily J member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    127385 (OR10J5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    127385 (OR10J5)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    127385 (OR10J5)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DUF2852 T7SS_ESX1_EccB SLC3A2_N
Other DBs
NCBI-GeneID: 127385
NCBI-ProteinID: NP_001004469
OMIM: 619546
HGNC: 14993
Ensembl: ENSG00000184155
Pharos: Q8NHC4(Tdark)
UniProt: Q8NHC4 A0A126GV70
Position
1:complement(159535078..159536007)
AA seq 309 aa
MKRKNFTEVSEFIFLGFSSFGKHQITLFVVFLTVYILTLVANIIIVTIICIDHHLHTPMY
FFLSMLASSETVYTLVIVPRMLLSLIFHNQPISLAGCATQMFFFVILATNNCFLLTAMGY
DRYVAICRPLRYTVIMSKGLCAQLVCGSFGIGLTMAVLHVTAMFNLPFCGTVVDHFFCDI
YPVMKLSCIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTFATC
VSHLTVVIVHCGCASIAYLKPKSESSIEKDLVLSVTYTIITPLLNPVVYSLRNKEVKDAL
CRVVGRNIS
NT seq 930 nt   +upstreamnt  +downstreamnt
atgaagagaaagaacttcacagaagtgtcagaattcattttcttgggattttctagcttt
ggaaagcatcagataaccctctttgtggttttcctaactgtctacattttaactctggtt
gctaacatcatcattgtgactatcatctgcattgaccatcatctccacactcccatgtat
ttcttcctaagcatgctggctagttcagagacggtgtacacactggtcattgtgccacga
atgcttttgagcctcatttttcataaccaacctatctccttggcaggctgtgctacacaa
atgttcttttttgttatcttggccactaataattgcttcctgcttactgcaatggggtat
gaccgctatgtggccatctgcagacccctgagatacactgtcatcatgagcaagggacta
tgtgcccagctggtgtgtgggtcctttggcattggtctgactatggcagttctccatgtg
acagccatgttcaatttgccgttctgtggcacagtggtagaccacttcttttgtgacatt
tacccagtcatgaaactttcttgcattgataccactatcaatgagataataaattatggt
gtaagttcatttgtgatttttgtgcccataggcctgatatttatctcctatgtccttgtc
atctcttccatccttcaaattgcctcagctgagggccggaagaagacctttgccacctgt
gtctcccacctcactgtggttattgtccactgtggctgtgcctccattgcctacctcaag
ccgaagtcagaaagttcaatagaaaaagaccttgttctctcagtgacgtacaccatcatc
actcccttgctgaaccctgttgtttacagtctgagaaacaaggaggtaaaggatgcccta
tgcagagttgtgggcagaaatatttcttaa

DBGET integrated database retrieval system