KEGG   Homo sapiens (human): 127550
Entry
127550            CDS       T01001                                 

Gene name
A3GALT2, A3GALT2P, IGB3S, IGBS3S
Definition
(RefSeq) alpha 1,3-galactosyltransferase 2
  KO
K20736  alpha-1,3-galactosyltransferase 2 [EC:2.4.1.87]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
hsa01100  Metabolic pathways
Drug target
Tergenpumatucel-L: D10429
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    127550 (A3GALT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    127550 (A3GALT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.87  N-acetyllactosaminide 3-alpha-galactosyltransferase
     127550 (A3GALT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  ABO blood group
   127550 (A3GALT2)
SSDB
Motif
Pfam: Glyco_transf_6
Other DBs
NCBI-GeneID: 127550
NCBI-ProteinID: NP_001073907
HGNC: 30005
Ensembl: ENSG00000184389
Vega: OTTHUMG00000004125
UniProt: U3KPV4
Position
1p35.1
AA seq 340 aa
MALKEGLRAWKRIFWRQILLTLGLLGLFLYGLPKFRHLEALIPMGVCPSATMSQLRDNFT
GALRPWARPEVLTCTPWGAPIIWDGSFDPDVAKQEARQQNLTIGLTIFAVGRYLEKYLER
FLETAEQHFMAGQSVMYYVFTELPGAVPRVALGPGRRLPVERVARERRWQDVSMARMRTL
HAALGGLPGREAHFMFCMDVDQHFSGTFGPEALAESVAQLHSWHYHWPSWLLPFERDAHS
AAAMAWGQGDFYNHAAVFGGSVAALRGLTAHCAGGLDWDRARGLEARWHDESHLNKFFWL
HKPAKVLSPEFCWSPDIGPRAEIRRPRLLWAPKGYRLLRN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctctcaaggagggactcagggcctggaagagaatcttctggcggcagatcctactt
acacttggcctcttaggcctgtttctgtatggcctccctaaattcaggcatctggaagcc
ctcatccccatgggcgtctgcccttcggccacaatgtcccagctgagagacaacttcaca
ggtgccctgcgtccctgggcccggcctgaagttctgacctgtaccccctggggggctccc
attatttgggatggctctttcgacccagatgtggccaagcaagaggctagacagcagaac
ctcaccattgggctgactatctttgctgtaggcagatacctggagaagtacctggagcgc
ttcctggagacggcggagcagcacttcatggcgggccagagcgtgatgtactacgtgttc
accgagcttccgggagcggtgccccgcgtggcgctgggcccgggacgccggctgcccgtg
gagcgcgtggcgcgcgagcggcgctggcaagacgtgtcgatggcgcgcatgcgcacgttg
cacgcggcgctgggcgggctgccgggccgcgaggcgcacttcatgttctgcatggacgtg
gaccagcacttcagcggcacttttgggcccgaggcgctggccgagtcggtggcgcagctg
cactcctggcactaccactggccgtcgtggctgctgcccttcgaacgcgacgcgcattcg
gccgccgcgatggcgtggggccagggcgacttctataaccacgcggcggtgttcgggggc
agcgtggcggcgctgcgcgggctgacggcgcactgtgcggggggcctggactgggaccgc
gcgcgcggcctggaggcgcgctggcacgacgagagccacctcaacaagttcttctggctg
cacaagcccgccaaggtgctgtcgcccgagttctgctggagcccggacatcggcccgcgg
gccgagatccgccgcccgcgactgctgtgggcgcccaaggggtaccggctgctgcggaac
tag

DBGET integrated database retrieval system